Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020326.1 | Gene: | Lrrc17 / 502715 | RGDID: | 1560165 | Length: | 446 | Species: | Rattus norvegicus |
Alignment Length: | 245 | Identity: | 63/245 - (25%) |
---|---|---|---|
Similarity: | 101/245 - (41%) | Gaps: | 54/245 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 IHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLEL 157
Fly 158 SNCQVERIENEAFVGMDNLEWLRLDGNRIGFI-QGTHILPKSLHGISLHSNRWNCDCRLLDIHFW 221
Fly 222 L-VNYNTPLAEEPKCMEPARLKGQVIKSL---------QREQLACLPEVSPQSSYTEVSEGRNMS 276
Fly 277 ITCLVRAIPEPKVLWLFNGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKR 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | |
leucine-rich repeat | 54..79 | CDD:275380 | |||
LRR_8 | 79..138 | CDD:290566 | 13/44 (30%) | ||
LRR_RI | <80..187 | CDD:238064 | 31/93 (33%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 3/9 (33%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 126..186 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 6/22 (27%) | ||
TPKR_C2 | 207..256 | CDD:301599 | 15/58 (26%) | ||
I-set | 258..361 | CDD:254352 | 13/69 (19%) | ||
Ig_2 | 263..361 | CDD:290606 | 10/64 (16%) | ||
Lrrc17 | NP_001020326.1 | leucine-rich repeat | 68..86 | CDD:275380 | 6/26 (23%) |
LRR_8 | 89..146 | CDD:290566 | 20/56 (36%) | ||
leucine-rich repeat | 89..111 | CDD:275380 | 7/21 (33%) | ||
LRR_4 | 110..151 | CDD:289563 | 14/40 (35%) | ||
leucine-rich repeat | 112..135 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 136..159 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 160..210 | CDD:275380 | 14/49 (29%) | ||
TPKR_C2 | 168..>204 | CDD:301599 | 11/35 (31%) | ||
leucine-rich repeat | 211..274 | CDD:275380 | 16/87 (18%) | ||
LRR_8 | 273..333 | CDD:290566 | |||
LRR_4 | 273..314 | CDD:289563 | |||
leucine-rich repeat | 275..298 | CDD:275380 | |||
LRR_4 | 299..337 | CDD:289563 | |||
leucine-rich repeat | 299..322 | CDD:275380 | |||
leucine-rich repeat | 323..346 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |