Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005036.1 | Gene: | vasn / 448556 | XenbaseID: | XB-GENE-941552 | Length: | 661 | Species: | Xenopus tropicalis |
Alignment Length: | 365 | Identity: | 94/365 - (25%) |
---|---|---|---|
Similarity: | 136/365 - (37%) | Gaps: | 107/365 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LPIWIPLLALL--AITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQV 66
Fly 67 LQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRL 131
Fly 132 SLSGNPIRELKTSAFRHLSFLTTLELSNCQ----------------------------------- 161
Fly 162 ---------VERIENEAFVGMDNLEWLRLDGNR-------------------IGFIQ-------- 190
Fly 191 ------------GTHILPKS-------LHGISLHSNRWNCDCRLLDIHFWLVNYNTPL--AEEPK 234
Fly 235 CMEPARLKGQVIKSLQREQLAC-------LPEVSPQSSYT 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 7/17 (41%) |
leucine-rich repeat | 54..79 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 79..138 | CDD:290566 | 26/58 (45%) | ||
LRR_RI | <80..187 | CDD:238064 | 43/169 (25%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 126..186 | CDD:290566 | 24/122 (20%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 8/66 (12%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 9/60 (15%) | ||
TPKR_C2 | 207..256 | CDD:301599 | 12/50 (24%) | ||
I-set | 258..361 | CDD:254352 | 4/10 (40%) | ||
Ig_2 | 263..361 | CDD:290606 | 2/5 (40%) | ||
vasn | NP_001005036.1 | LRRNT | 21..52 | CDD:214470 | 12/34 (35%) |
leucine-rich repeat | 52..75 | CDD:275380 | 4/22 (18%) | ||
LRR 1 | 52..72 | 4/19 (21%) | |||
LRR | <60..>276 | CDD:227223 | 50/217 (23%) | ||
LRR 2 | 75..96 | 8/22 (36%) | |||
leucine-rich repeat | 76..99 | CDD:275380 | 10/24 (42%) | ||
LRR_8 | 99..158 | CDD:338972 | 26/58 (45%) | ||
LRR 3 | 99..120 | 9/20 (45%) | |||
leucine-rich repeat | 100..123 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 123..144 | 10/20 (50%) | |||
leucine-rich repeat | 124..147 | CDD:275380 | 10/22 (45%) | ||
LRR 5 | 147..168 | 6/20 (30%) | |||
leucine-rich repeat | 148..169 | CDD:275380 | 6/20 (30%) | ||
LRR 6 | 169..189 | 0/19 (0%) | |||
leucine-rich repeat | 170..191 | CDD:275380 | 0/20 (0%) | ||
LRR 7 | 191..212 | 1/20 (5%) | |||
leucine-rich repeat | 192..215 | CDD:275380 | 2/22 (9%) | ||
LRR 8 | 215..237 | 5/21 (24%) | |||
leucine-rich repeat | 216..235 | CDD:275380 | 4/18 (22%) | ||
leucine-rich repeat | 236..260 | CDD:275380 | 3/23 (13%) | ||
LRR 9 | 238..258 | 3/19 (16%) | |||
LRR 10 | 259..281 | 3/21 (14%) | |||
leucine-rich repeat | 261..281 | CDD:275380 | 3/19 (16%) | ||
PCC | 265..>344 | CDD:188093 | 18/78 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 348..395 | 4/15 (27%) | |||
EGF | 407..438 | CDD:333761 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 591..661 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 124 | 1.000 | Inparanoid score | I4567 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm49155 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |