DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Flrt1

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_958813.1 Gene:Flrt1 / 396184 MGIID:3026647 Length:674 Species:Mus musculus


Alignment Length:243 Identity:60/243 - (24%)
Similarity:91/243 - (37%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTN-LVELDLSENALQ 115
            |..:.|:...|::..:..|.....|...|:.::||||.|..|..    ||.: |.||.|.:|.:.
Mouse   151 PLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPS----GLPHTLEELRLDDNRIS 211

  Fly   116 NVPSETFQDYSSLMRLSLSGNPI--RELKTSAFRHLSFLTTLE---------------------- 156
            .:|...|:..:||.||.|.||.:  :.:....|..|..||.|.                      
Mouse   212 TIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLY 276

  Fly   157 LSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHILPKSLHG-------ISLHSNRWNCDCR 214
            |.:..:..|.......|..||.|.|..|.:      ..||:.|..       :.|.:|.|.|.|.
Mouse   277 LQDNAISHIPYNTLAKMRELERLDLSNNNL------TTLPRGLFDDLGNLAQLLLRNNPWFCGCN 335

  Fly   215 LLDIHFW------LVNYNTPLAEEPKCMEPARLKGQVIKSLQREQLAC 256
            |:.:..|      :||....:     |..|.:::|..||.:..|...|
Mouse   336 LMWLRDWVRARAAVVNVRGLM-----CQGPEKVRGMAIKDITSEMDEC 378

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 60/243 (25%)
leucine-rich repeat 54..79 CDD:275380 4/24 (17%)
LRR_8 79..138 CDD:290566 23/59 (39%)
LRR_RI <80..187 CDD:238064 36/131 (27%)
leucine-rich repeat 80..103 CDD:275380 9/22 (41%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
LRR_8 126..186 CDD:290566 20/83 (24%)
leucine-rich repeat 128..151 CDD:275380 8/24 (33%)
leucine-rich repeat 152..175 CDD:275380 6/44 (14%)
leucine-rich repeat 176..198 CDD:275380 7/21 (33%)
TPKR_C2 207..256 CDD:301599 14/54 (26%)
I-set 258..361 CDD:254352
Ig_2 263..361 CDD:290606
Flrt1NP_958813.1 PRK15370 <58..>329 CDD:185268 45/187 (24%)
leucine-rich repeat 108..128 CDD:275380