| Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
| Alignment Length: | 213 | Identity: | 48/213 - (22%) |
|---|---|---|---|
| Similarity: | 91/213 - (42%) | Gaps: | 25/213 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 VECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRG 100
Fly 101 LTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRH--LSFLTTLELSNCQVE 163
Fly 164 RIEN--------EAFVGMDNLEWLRLDGNRIGFIQGTHILPKSLHGISLHSNRWN-CDCRLLDIH 219
Fly 220 FWLVNYNTPLAEEPKCME 237 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 3/15 (20%) |
| leucine-rich repeat | 54..79 | CDD:275380 | 7/24 (29%) | ||
| LRR_8 | 79..138 | CDD:290566 | 19/58 (33%) | ||
| LRR_RI | <80..187 | CDD:238064 | 28/116 (24%) | ||
| leucine-rich repeat | 80..103 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 126..186 | CDD:290566 | 12/69 (17%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 4/30 (13%) | ||
| leucine-rich repeat | 176..198 | CDD:275380 | 4/21 (19%) | ||
| TPKR_C2 | 207..256 | CDD:301599 | 6/32 (19%) | ||
| I-set | 258..361 | CDD:254352 | |||
| Ig_2 | 263..361 | CDD:290606 | |||
| Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 3/16 (19%) |
| LRR_8 | 58..118 | CDD:290566 | 18/61 (30%) | ||
| leucine-rich repeat | 60..83 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | <94..>249 | CDD:238064 | 36/159 (23%) | ||
| LRR_8 | 106..167 | CDD:290566 | 20/61 (33%) | ||
| LRR_4 | 106..145 | CDD:289563 | 15/39 (38%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 131..154 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 157..178 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 4/26 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24366 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||