DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Lrt

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:558 Identity:116/558 - (20%)
Similarity:208/558 - (37%) Gaps:131/558 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QTVECGGQQLSNLPEGMDPGTQV-----LNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRI 93
            :.::.||.:|.:..:.:...:|.     |:...|.|....||:.| ..:.||:.:.|:||.:..|
  Fly   298 EVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTL-PGMRNLESLNLNRNLIKSI 361

  Fly    94 HEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELS 158
            ..||....:.||.|.|..|.:..:....|....:|..|.||.|.|..:.:::.:|||.||.|:|:
  Fly   362 QNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLT 426

  Fly   159 NCQVERIENEAFVGMDNLEWLRLDGNRIGFI-----QGTHILPKSLHGISLHSNRWNCDCRLLDI 218
            :..:..:.::....:.:|..|||.||.|..:     .|.    :.|..:.:..|..:|||.:...
  Fly   427 HNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGA----RELESLQMQENPLSCDCSIRPF 487

  Fly   219 HFWLVNYNTPLAEEPKCMEPARLKGQVIKSLQREQLAC-LPEVSPQSS----YTEVSEGRNMSIT 278
            ..||.......:....|:.|.||:|..:..:..|.|:| :..|...::    :.|.....|.  |
  Fly   488 AEWLQESQLHSSLSASCVTPPRLEGAPLLQVPVETLSCDMDNVEKDNANIMQHLETLAKPNQ--T 550

  Fly   279 CLVRAIPEPKVL--------------WLFNGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEI 329
            ..::.:.|..:|              ||.|  :...|.:.|.:.:|           .||..:||
  Fly   551 SPIKDLSEEIILHELHFSTDYGLILTWLLN--LSKKDYMCDAIFVY-----------KEEHINEI 602

  Fly   330 FIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVIIKEPPVVNEVSFPRDYMNYIVASSAGGGIIFV 394
            .|      ||....|..:.:.|..    |:.||:   |..:.:.....|...:|..........:
  Fly   603 LI------DNSPIHCESKVVNGQN----TVSVIV---PDSSSLEIGESYRFCLVMIQEQKPDSEL 654

  Fly   395 VLLCTIVVKCKKTSEPA--------------------------------KQRKKCDQVTSIAGGT 427
            .:.|:.:.:.:::|..|                                .||:    ..|:.|..
  Fly   655 NIGCSNITRLERSSPGAVPVSRQYQRRPYYNANELKPEVVHDAGEDYQVNQRR----FNSVVGSQ 715

  Fly   428 DSSTGSTQDTGMGMMKCASILNDGGDSMNGN--PGLLLGDTLTPT----------KAANGAAGGG 480
            ...|  .|.|   ::...:::    ||:|.:  |||.||..:|..          :...|::|||
  Fly   716 PQQT--QQST---LLHSYTVI----DSLNKSFLPGLGLGVLVTSVLVLIWGATRIRQTGGSSGGG 771

  Fly   481 IILGNQMKQNLLLYATPNSAQQQLQLNVNLMGTGPGSP 518
            ...|:.:..|            ...::.|...:.||:|
  Fly   772 GRNGDSIDSN------------SSSMHNNNNNSRPGTP 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 3/17 (18%)
leucine-rich repeat 54..79 CDD:275380 7/29 (24%)
LRR_8 79..138 CDD:290566 19/58 (33%)
LRR_RI <80..187 CDD:238064 32/106 (30%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
leucine-rich repeat 104..127 CDD:275380 6/22 (27%)
LRR_8 126..186 CDD:290566 19/59 (32%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 4/22 (18%)
leucine-rich repeat 176..198 CDD:275380 8/26 (31%)
TPKR_C2 207..256 CDD:301599 13/48 (27%)
I-set 258..361 CDD:254352 22/120 (18%)
Ig_2 263..361 CDD:290606 21/115 (18%)
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 6/35 (17%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 2/8 (25%)
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 47/185 (25%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380 4/23 (17%)
LRR_8 322..382 CDD:290566 19/60 (32%)
leucine-rich repeat 323..347 CDD:275380 6/24 (25%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
LRR_8 370..428 CDD:290566 19/57 (33%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 418..478 CDD:290566 15/63 (24%)
leucine-rich repeat 420..443 CDD:275380 4/22 (18%)
leucine-rich repeat 444..467 CDD:275380 8/26 (31%)
LRRCT 476..526 CDD:214507 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.