DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Lrrc24

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001129368.1 Gene:Lrrc24 / 362945 RGDID:1308720 Length:521 Species:Rattus norvegicus


Alignment Length:358 Identity:101/358 - (28%)
Similarity:152/358 - (42%) Gaps:29/358 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPLLALLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERF 72
            :|||..|...|...|..|.|.    ..|||||..:|..:|.|:.||||.|....|::..|  |:.
  Rat    18 LPLLPGLPPRATGCPAACRCY----SATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHL--EQG 76

  Fly    73 LRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNP 137
            ....|..|:.:||..|.|..:...|||....|:||.|:.|.|:.:....|.....|..|.|:||.
  Rat    77 ALAPLAALRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQ 141

  Fly   138 IRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHILP-KSLHG 201
            :.:|....|.||..|..|.|....:|.:|::|..|:.:|..|.|..|::|.|....:.| .||..
  Rat   142 LAKLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLSSLQV 206

  Fly   202 ISLHSNRWNCDCRLLDIHFWLVNYNTPL--AEEPK--CMEPARLKGQVIKSLQREQLACL-PEVS 261
            :.|..|.|.|||.|..:..|:......|  :.:.|  |.||.||..|.:..:....|.|: |.|:
  Rat   207 LRLTENPWRCDCALHWLGSWIKEGGRRLLSSRDKKITCAEPPRLALQSLLEVSGGSLICIPPSVN 271

  Fly   262 PQSSYTEVSEGRNMSITCLVRAIPEPKVLWL-----FNGQVMSNDSLMDNLHMYYYIDETIGVSG 321
            .:......:.|.::.:.|.....|:|.|:|.     .:|:..:...|...         ..|:.|
  Rat   272 AEPPELTANLGEDLQVACQASGYPQPLVVWRKMLQPRDGKPQAQVQLEGG---------APGLGG 327

  Fly   322 ---AEEKRSEIFIYNVGAEDNGTFSCVGQNIAG 351
               .:.....:|:.|:.....|.:.|...|..|
  Rat   328 HATRDTGSGMLFLTNITLAHAGKYECEATNAGG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 8/17 (47%)
leucine-rich repeat 54..79 CDD:275380 7/24 (29%)
LRR_8 79..138 CDD:290566 20/58 (34%)
LRR_RI <80..187 CDD:238064 35/106 (33%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
LRR_8 126..186 CDD:290566 20/59 (34%)
leucine-rich repeat 128..151 CDD:275380 9/22 (41%)
leucine-rich repeat 152..175 CDD:275380 7/22 (32%)
leucine-rich repeat 176..198 CDD:275380 7/22 (32%)
TPKR_C2 207..256 CDD:301599 16/52 (31%)
I-set 258..361 CDD:254352 18/102 (18%)
Ig_2 263..361 CDD:290606 16/97 (16%)
Lrrc24NP_001129368.1 leucine-rich repeat 61..83 CDD:275380 6/23 (26%)
PPP1R42 63..>212 CDD:411060 46/150 (31%)
LRR_8 84..142 CDD:404697 20/57 (35%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
PCC 188..>259 CDD:188093 22/70 (31%)
Ig_3 267..357 CDD:404760 16/98 (16%)
Ig strand A 267..271 CDD:409353 1/3 (33%)
Ig strand A' 276..280 CDD:409353 0/3 (0%)
Ig strand B 283..292 CDD:409353 1/8 (13%)
Ig strand C 298..304 CDD:409353 2/5 (40%)
Ig strand D 330..333 CDD:409353 0/2 (0%)
Ig strand E 336..342 CDD:409353 1/5 (20%)
Ig strand F 349..357 CDD:409353 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.