| Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848665.1 | Gene: | RTN4RL2 / 349667 | HGNCID: | 23053 | Length: | 420 | Species: | Homo sapiens |
| Alignment Length: | 302 | Identity: | 82/302 - (27%) |
|---|---|---|---|
| Similarity: | 122/302 - (40%) | Gaps: | 53/302 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 LLALLAITAACP--PEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQ---- 68
Fly 69 ----------------------------------SERFLR-------MDLLNLQKIYLSRNQLIR 92
Fly 93 IHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLEL 157
Fly 158 SNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHI--LPKSLHGISLHSNRWNCDCRLLDIHF 220
Fly 221 WLVNYNTPLAEEPKCMEPARLKGQVIKSLQREQLACLPEVSP 262 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 5/17 (29%) |
| leucine-rich repeat | 54..79 | CDD:275380 | 9/69 (13%) | ||
| LRR_8 | 79..138 | CDD:290566 | 23/58 (40%) | ||
| LRR_RI | <80..187 | CDD:238064 | 38/106 (36%) | ||
| leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 126..186 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 176..198 | CDD:275380 | 7/23 (30%) | ||
| TPKR_C2 | 207..256 | CDD:301599 | 11/48 (23%) | ||
| I-set | 258..361 | CDD:254352 | 2/5 (40%) | ||
| Ig_2 | 263..361 | CDD:290606 | 82/302 (27%) | ||
| RTN4RL2 | NP_848665.1 | LRR_8 | 60..117 | CDD:290566 | 6/56 (11%) |
| leucine-rich repeat | 62..83 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 0/22 (0%) | ||
| LRR_RI | 103..>261 | CDD:238064 | 48/158 (30%) | ||
| LRR_8 | 108..167 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 108..132 | CDD:275380 | 4/23 (17%) | ||
| leucine-rich repeat | 133..156 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 156..215 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 157..180 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 181..204 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 204..262 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 7/23 (30%) | ||
| TPKR_C2 | 261..311 | CDD:301599 | 11/50 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||