Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955921.2 | Gene: | lgi1a / 323011 | ZFINID: | ZDB-GENE-030131-1731 | Length: | 537 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 53/253 - (20%) |
---|---|---|---|
Similarity: | 94/253 - (37%) | Gaps: | 62/253 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LLALLAI-----TAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQS 69
Fly 70 ERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLS 134
Fly 135 GNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHILPKSL 199
Fly 200 HGISLHSNRWNCDCRLLDIHFWLVNYNTPLAEEPKCMEPARLKGQVIKSLQREQLACL 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 2/17 (12%) |
leucine-rich repeat | 54..79 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 79..138 | CDD:290566 | 18/58 (31%) | ||
LRR_RI | <80..187 | CDD:238064 | 22/106 (21%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 126..186 | CDD:290566 | 10/59 (17%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 0/21 (0%) | ||
TPKR_C2 | 207..256 | CDD:301599 | 12/48 (25%) | ||
I-set | 258..361 | CDD:254352 | 53/253 (21%) | ||
Ig_2 | 263..361 | CDD:290606 | |||
lgi1a | NP_955921.2 | LRR_8 | 57..113 | CDD:290566 | 16/57 (28%) |
LRR_4 | 77..120 | CDD:289563 | 12/44 (27%) | ||
leucine-rich repeat | 79..102 | CDD:275378 | 9/24 (38%) | ||
LRR_8 | 101..161 | CDD:290566 | 17/106 (16%) | ||
LRR_4 | 101..141 | CDD:289563 | 11/63 (17%) | ||
leucine-rich repeat | 103..126 | CDD:275378 | 4/22 (18%) | ||
leucine-rich repeat | 127..150 | CDD:275378 | 9/69 (13%) | ||
leucine-rich repeat | 151..163 | CDD:275378 | 3/11 (27%) | ||
TPKR_C2 | 159..207 | CDD:301599 | 12/48 (25%) | ||
EPTP | 211..252 | CDD:281697 | |||
EPTP | 257..298 | CDD:281697 | |||
EPTP | 303..349 | CDD:281697 | |||
EPTP | 352..394 | CDD:281697 | |||
EPTP | 399..441 | CDD:281697 | |||
EPTP | 444..485 | CDD:281697 | |||
EPTP | 490..530 | CDD:281697 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |