DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Amigo3

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_835280.1 Gene:Amigo3 / 316003 RGDID:631413 Length:508 Species:Rattus norvegicus


Alignment Length:546 Identity:116/546 - (21%)
Similarity:202/546 - (36%) Gaps:110/546 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIPLLALLA-----------ITAACPPE------VCVCKWKGGKQTVECGGQQLSNLPEGMDPGT 54
            |:.||.||.           :....||:      .|||    ....:.|.|:.|.:||..:....
  Rat     3 WLVLLGLLLCMLGAGSGTSDLEGVLPPDPHNCPNKCVC----AADVLSCAGRGLQDLPAALPATA 63

  Fly    55 QVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPS 119
            ..|:.|.|||:.|.....  ..|..|:.:||..|:|..:....|...:.|..||||.|.|:.:.:
  Rat    64 AELDLSHNALKRLHPGWL--APLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRT 126

  Fly   120 ETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTL-----ELSNCQVERIENEAFVGMDNLEWL 179
            ........|.:|.|..|.:..|...||:.||.|:.|     |||:.....:..   :|:..|..|
  Rat   127 YDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHG---LGLTRLRTL 188

  Fly   180 RLDGNRIGFIQGTHI--LPKSL-HGISLHSNRWNCDCRLLD-IHFWLVNYNTPLAE---EPKCM- 236
            .|..|.:|.:....:  ||..| :.:.||:|...|||.|.. :..|.....:.|.:   |..|: 
  Rat   189 DLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLA 253

  Fly   237 ---EPARLK----GQVIKSLQREQLACLP--EVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWL 292
               ..:|::    .:|.|:.   .:|..|  |:..:..:|.|  |:::.:.|.. .:|..:|.|:
  Rat   254 FKVAESRVRFFEHSRVFKNC---SVAAAPGLELPEEELHTHV--GQSLRLFCNT-TVPAARVAWV 312

  Fly   293 F-NGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCV--GQNIAGTTF 354
            . ..:::......|. .:....|.::.:...:|:.:            |.|.|:  |..:.....
  Rat   313 SPKNELLVAPGSQDG-SIAVLADGSLAIGRVQEQHA------------GLFVCLASGPRLHHNQT 364

  Fly   355 SNYTLRVIIKEP-PVVNEVSFPRDYMNYIVASSAGGGIIFVVLL-----CTIVVKC--------- 404
            ..|.:.|....| |......| ...:..||      |::.|:|.     |....:|         
  Rat   365 LEYNVSVHKPRPEPEAFNTGF-TTLLGCIV------GLVLVLLYLFAPPCRGCCRCCRRACRNRC 422

  Fly   405 -KKTSEPAKQRKKCDQVTSIAGGTDSSTGSTQDTGMGMMKCASILNDGGDSMNGNPGLLLG---D 465
             .:.|.|.::   ....:|:...|.....|.:   ..:.|..:.|..|...:||...|.:.   |
  Rat   423 WPRASSPLQE---LSAQSSVLSTTPPDAPSRK---ASVHKHVAFLEPGKKGLNGRVQLAVAEDFD 481

  Fly   466 TLTP--------TKAANGAAGGGIIL 483
            ...|        :::|:.....|:::
  Rat   482 LCNPMGLQLKAGSESASSTGSEGLMM 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 5/17 (29%)
leucine-rich repeat 54..79 CDD:275380 7/24 (29%)
LRR_8 79..138 CDD:290566 17/58 (29%)
LRR_RI <80..187 CDD:238064 32/111 (29%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
LRR_8 126..186 CDD:290566 19/64 (30%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 6/27 (22%)
leucine-rich repeat 176..198 CDD:275380 7/23 (30%)
TPKR_C2 207..256 CDD:301599 12/60 (20%)
I-set 258..361 CDD:254352 17/107 (16%)
Ig_2 263..361 CDD:290606 15/100 (15%)
Amigo3NP_835280.1 LRR 1 62..83 6/22 (27%)
LRR_8 65..121 CDD:404697 19/57 (33%)
leucine-rich repeat 65..86 CDD:275380 7/22 (32%)
LRR 2 86..107 6/20 (30%)
leucine-rich repeat 87..110 CDD:275380 6/22 (27%)
LRR 3 110..131 7/20 (35%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
LRR 4 134..155 7/20 (35%)
leucine-rich repeat 135..158 CDD:275380 8/22 (36%)
LRR_8 142..193 CDD:404697 15/53 (28%)
LRR 5 158..178 5/19 (26%)
leucine-rich repeat 159..184 CDD:275380 6/27 (22%)
LRR 6 184..207 5/22 (23%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
Ig_3 279..355 CDD:404760 15/91 (16%)
Ig strand B 295..303 CDD:409353 1/8 (13%)
Ig strand C 308..313 CDD:409353 2/4 (50%)
Ig strand C' 316..318 CDD:409353 0/1 (0%)
Ig strand D 329..332 CDD:409353 0/2 (0%)
Ig strand E 335..342 CDD:409353 0/6 (0%)
Ig strand F 348..355 CDD:409353 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.