DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and hfw

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster


Alignment Length:494 Identity:103/494 - (20%)
Similarity:174/494 - (35%) Gaps:172/494 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LALLAITAACPPEVCVCKWKG---GKQTVECGGQQLSNLPEGMDPGTQVLN----FSGNALQVLQ 68
            ::.|.:.::|..   :.||..   ...|||  ...|||      |..:.|.    ..||..:::.
  Fly   199 ISQLTMISSCSN---ISKWTNLHVRNMTVE--DMDLSN------PIFRSLQSLAVTDGNITRLVN 252

  Fly    69 SERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSL 133
            :  |.|:..|..  :.:|.|.:..||.:|.:.:.:|....:|.|.|..||   .::.:..:.|.:
  Fly   253 A--FPRLSALKC--LNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVP---HRNQNKNITLDI 310

  Fly   134 SGN------PIRELKTSAFRHLSFLTTLELSNCQVER----IENEAFVGMDNLEWLRLDGNRIGF 188
            |||      |:.|:..:  ..::||.. :.|.||...    .::...|.::.||      ||...
  Fly   311 SGNMRMLCTPLNEIIYT--ESINFLNP-KHSYCQYNATHTWFQSTDKVSVEQLE------NRKRC 366

  Fly   189 IQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTPLAEEPKCMEPARLKGQVIKSLQREQ 253
            :....::|          |..:|:|.|.:|  .::..|   ..:|:|.......|          
  Fly   367 VTNCPVIP----------NYGSCNCTLENI--MIIQDN---QSKPQCHVDCSNLG---------- 406

  Fly   254 LACLPEVSPQSSYTEVSEGRNMSITCL----------------------VRAIPE---PKVLWLF 293
            |..||:..|.:::  :....|..||.|                      :.:|.|   .|.:..|
  Fly   407 LVELPQRLPDNTF--MLNITNNKITSLGDYFHTNPTYHNINRLLADNNQISSIYEFEGTKFIETF 469

  Fly   294 NGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNI--AGTTF-- 354
            ....|.|:||                    .|..|.|:.| ...|:|    :|:.|  ||...  
  Fly   470 QRIYMRNNSL--------------------SKIPEYFLNN-ALMDSG----LGRRIYLAGNKLQC 509

  Fly   355 ---SNYTLRVIIKE----------------PPVVNEVSFPR---------DYMNYIVASSAGGGI 391
               |..||:..:||                |..|.|:...:         ||:.|::|:.     
  Fly   510 DCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQEAKLCQSPPDWTDYIYYLIAAE----- 569

  Fly   392 IFVVLLCTIVVKCK------KTSE----PAKQRKK--CD 418
              |:||..::.|..      ||:.    ||.:..|  ||
  Fly   570 --VLLLLALITKVSYDYWVFKTAGYLPWPASKMPKLPCD 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 6/17 (35%)
leucine-rich repeat 54..79 CDD:275380 5/28 (18%)
LRR_8 79..138 CDD:290566 15/64 (23%)
LRR_RI <80..187 CDD:238064 27/116 (23%)
leucine-rich repeat 80..103 CDD:275380 5/22 (23%)
leucine-rich repeat 104..127 CDD:275380 6/22 (27%)
LRR_8 126..186 CDD:290566 15/69 (22%)
leucine-rich repeat 128..151 CDD:275380 6/28 (21%)
leucine-rich repeat 152..175 CDD:275380 5/26 (19%)
leucine-rich repeat 176..198 CDD:275380 5/21 (24%)
TPKR_C2 207..256 CDD:301599 10/48 (21%)
I-set 258..361 CDD:254352 27/134 (20%)
Ig_2 263..361 CDD:290606 25/129 (19%)
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 14/62 (23%)
leucine-rich repeat 237..259 CDD:275378 5/23 (22%)
leucine-rich repeat 260..283 CDD:275378 6/24 (25%)
leucine-rich repeat 284..304 CDD:275378 6/22 (27%)
leucine-rich repeat 420..443 CDD:275378 4/22 (18%)
leucine-rich repeat 444..465 CDD:275378 2/20 (10%)
leucine-rich repeat 466..497 CDD:275378 11/55 (20%)
leucine-rich repeat 498..509 CDD:275378 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.