DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Islr

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_006511267.1 Gene:Islr / 26968 MGIID:1349645 Length:436 Species:Mus musculus


Alignment Length:431 Identity:101/431 - (23%)
Similarity:162/431 - (37%) Gaps:103/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDL 77
            ||.:..|| ||.|.|..|.|.|..:|..:.|..:|.|.......|:.|.|.|..|....|..:.|
Mouse    20 LLNLVRAC-PEPCDCGEKYGFQIADCAYRDLEGVPPGFPANVTTLSLSANRLPGLPEGAFREVPL 83

  Fly    78 LNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELK 142
              ||.::|:.|::..:...|...|::|..||||.|.|.........:.|:|..|.:..|.:..:.
Mouse    84 --LQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLLSEFAWSDLHNLSALQLLKMDSNELAFIP 146

  Fly   143 TSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRI-GFIQGTHILPKSLHGISLHS 206
            ..||..||.|.:|:|::                        ||: ...:||.....:|..:.::.
Mouse   147 RDAFSSLSALRSLQLNH------------------------NRLHALAEGTFAPLTALSHLQIND 187

  Fly   207 NRWNCDCRLLDIHFWLVNYNTPLAEEPK--CMEPARLKGQVIKSLQREQLACLPEVSP--QSSY- 266
            |.::|.|.::....|.:.....:.|:..  |..|     .|:|.:...:|..||..:|  |.|| 
Mouse   188 NPFDCTCGIVWFKTWALASAVSIPEQDNIACTTP-----HVLKGIPLGRLPPLPCSAPSVQLSYQ 247

  Fly   267 -----TEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSNDSLMDNLH----MYYYIDETIGVSG- 321
                 .|:..|..:::.|.|...|.|::.|              ::|    ........:|..| 
Mouse   248 PSQDGAELRPGFVLALHCDVDGQPVPQLHW--------------HIHTPGGTVEIASPNVGTDGR 298

  Fly   322 --------AEEKRSEIF------IYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVIIKEP------ 366
                    :.:.|.:.|      |.:.|..:.||:||:..|..|:..|  ::.|.:..|      
Mouse   299 ALPGALATSGQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAES--SVNVALATPGEGGED 361

  Fly   367 -----------------PVVNEV--SFPRDYMNYIVASSAG 388
                             .|.|||  |.|.|.:..|..|.||
Mouse   362 AVGHKFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 5/17 (29%)
leucine-rich repeat 54..79 CDD:275380 7/24 (29%)
LRR_8 79..138 CDD:290566 17/58 (29%)
LRR_RI <80..187 CDD:238064 26/107 (24%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
LRR_8 126..186 CDD:290566 12/59 (20%)
leucine-rich repeat 128..151 CDD:275380 6/22 (27%)
leucine-rich repeat 152..175 CDD:275380 3/22 (14%)
leucine-rich repeat 176..198 CDD:275380 4/22 (18%)
TPKR_C2 207..256 CDD:301599 10/50 (20%)
I-set 258..361 CDD:254352 26/129 (20%)
Ig_2 263..361 CDD:290606 24/122 (20%)
IslrXP_006511267.1 leucine-rich repeat 40..59 CDD:275380 5/18 (28%)
LRR_8 59..118 CDD:338972 19/60 (32%)
leucine-rich repeat 60..83 CDD:275380 6/22 (27%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
LRR_8 107..166 CDD:338972 19/82 (23%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 7/46 (15%)
PCC 161..>235 CDD:188093 16/102 (16%)
Ig 263..349 CDD:319273 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.