DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and LRIT1

DIOPT Version :10

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:405 Identity:109/405 - (26%)
Similarity:159/405 - (39%) Gaps:66/405 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLALLAITAACPPEV-------CVCK----WKGGK-QTVECGGQQLSNLPEGMDPGTQVLNFSGN 62
            :|.|||:  |.||:.       |.|.    ..|.| :||.|....::..|..:.|.|..|.....
Human     7 MLWLLAL--AWPPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPPDTSRLRLERT 69

  Fly    63 ALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYSS 127
            |::.:..|.|  ..|..|::::|..|.|..::....|||..|.||.|..|.|...|....:|...
Human    70 AIRRVPGEAF--RPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLAAFPWAALRDAPK 132

  Fly   128 LMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGT 192
            |..|.|..|.:..:...|.|.|..||.|:||:.|:.|:..|..|...:||              |
Human   133 LRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLMRLPQELIVSWAHLE--------------T 183

  Fly   193 HILPKSLHG---ISLHSNRWNCDCRLLDIHFWLVNYNTPLA---EEPKCMEPARLKGQVIKSLQR 251
            .|.|...|.   :.|..|.|.|||||.|:...|..:...||   .|.:|..|..|.|.....|:.
Human   184 GIFPPGHHPRRVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSLAGVAFSQLEL 248

  Fly   252 EQLACL-PEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLW-LFNGQVMSNDSLMDNLHMYYYID 314
            .:  |. ||:.|..:......|....:.|....:|.|::.| ..||:.::.     .:|.....|
Human   249 RK--CQGPELHPGVASIRSLLGGTALLRCGATGVPGPEMSWRRANGRPLNG-----TVHQEVSSD 306

  Fly   315 ET----IGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVIIKEPPVVNEVSFP 375
            .|    :|:..            |...|:|.:.|..:|..|.  |...:.:|:.|||...|.|  
Human   307 GTSWTLLGLPA------------VSHLDSGDYICQAKNFLGA--SETVISLIVTEPPTSTEHS-- 355

  Fly   376 RDYMNYIVASSAGGG 390
             .....:.|.:.|||
Human   356 -GSPGALWARTGGGG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 LRR <34..>204 CDD:443914 48/172 (28%)
leucine-rich repeat 34..52 CDD:275380 4/17 (24%)
leucine-rich repeat 54..79 CDD:275380 6/24 (25%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
leucine-rich repeat 128..151 CDD:275380 7/22 (32%)
leucine-rich repeat 152..175 CDD:275380 9/22 (41%)
leucine-rich repeat 176..198 CDD:275380 5/21 (24%)
LRRCT 207..256 CDD:214507 17/51 (33%)
Ig_3 258..348 CDD:464046 18/94 (19%)
LRIT1NP_056428.1 LRR 1 60..81 5/22 (23%)
leucine-rich repeat 61..84 CDD:275378 6/24 (25%)
LRR <63..>174 CDD:443914 34/112 (30%)
LRR 2 84..105 4/20 (20%)
leucine-rich repeat 85..132 CDD:275378 15/46 (33%)
LRR 3 108..129 7/20 (35%)
LRR 4 132..153 5/20 (25%)
leucine-rich repeat 133..156 CDD:275378 7/22 (32%)
LRR 5 156..177 8/20 (40%)
leucine-rich repeat 157..180 CDD:275378 9/22 (41%)
leucine-rich repeat 181..205 CDD:275378 9/37 (24%)
LRRCT 201..>240 CDD:214507 15/38 (39%)
IG_like 267..345 CDD:214653 18/96 (19%)
Ig strand B 271..275 CDD:409353 0/3 (0%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..312 CDD:409353 1/3 (33%)
Ig strand F 325..330 CDD:409353 1/4 (25%)
Ig strand G 338..341 CDD:409353 0/2 (0%)
FN3 431..498 CDD:214495
LRR 6. /evidence=ECO:0000305 571..594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.