Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352040.1 | Gene: | Slitrk4 / 245446 | MGIID: | 2442509 | Length: | 837 | Species: | Mus musculus |
Alignment Length: | 334 | Identity: | 87/334 - (26%) |
---|---|---|---|
Similarity: | 149/334 - (44%) | Gaps: | 46/334 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IWIPLL--ALLAITAA---CPPEVC-VCKWKGGKQTVECGGQQLS-NLPEGMDP---GTQVLNFS 60
Fly 61 GNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDY 125
Fly 126 SSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNR----- 185
Fly 186 -IGFIQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWLVN--YNTPLAEEPKCMEPARLKGQVIK 247
Fly 248 SLQREQLA-----------CLPEVSPQSSYTEVSEGRNMSITCLVRAIPEP-------KVLWLFN 294
Fly 295 GQVMSNDSL 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 2/18 (11%) |
leucine-rich repeat | 54..79 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 79..138 | CDD:290566 | 18/58 (31%) | ||
LRR_RI | <80..187 | CDD:238064 | 31/112 (28%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 126..186 | CDD:290566 | 16/65 (25%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 9/27 (33%) | ||
TPKR_C2 | 207..256 | CDD:301599 | 19/61 (31%) | ||
I-set | 258..361 | CDD:254352 | 11/53 (21%) | ||
Ig_2 | 263..361 | CDD:290606 | 10/48 (21%) | ||
Slitrk4 | NP_001352040.1 | internalin_A | <15..>253 | CDD:380193 | 69/245 (28%) |
LRR 1 | 60..81 | 7/20 (35%) | |||
leucine-rich repeat | 63..84 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 83..143 | CDD:404697 | 18/61 (30%) | ||
LRR 2 | 84..105 | 6/20 (30%) | |||
leucine-rich repeat | 85..108 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 108..129 | 7/20 (35%) | |||
leucine-rich repeat | 109..132 | CDD:275380 | 7/22 (32%) | ||
LRR 4 | 132..153 | 6/20 (30%) | |||
leucine-rich repeat | 133..156 | CDD:275380 | 7/22 (32%) | ||
LRR 5 | 156..177 | 4/21 (19%) | |||
leucine-rich repeat | 157..182 | CDD:275380 | 5/25 (20%) | ||
LRR 6 | 179..200 | 7/20 (35%) | |||
leucine-rich repeat | 183..325 | CDD:275380 | 39/148 (26%) | ||
leucine-rich repeat | 326..402 | CDD:275380 | 1/1 (100%) | ||
leucine-rich repeat | 358..378 | CDD:275380 | |||
PPP1R42 | 359..>550 | CDD:411060 | |||
LRR 7 | 378..399 | ||||
LRR_8 | 402..461 | CDD:404697 | |||
LRR 8 | 402..423 | ||||
leucine-rich repeat | 403..426 | CDD:275380 | |||
LRR 9 | 426..447 | ||||
leucine-rich repeat | 427..450 | CDD:275380 | |||
LRR 10 | 450..471 | ||||
leucine-rich repeat | 451..472 | CDD:275380 | |||
LRR 11 | 474..495 | ||||
leucine-rich repeat | 475..496 | CDD:275380 | |||
LRR 12 | 497..518 | ||||
leucine-rich repeat | 498..522 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 113 | 1.000 | Inparanoid score | I4837 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |