DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and Lingo1

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_006511149.1 Gene:Lingo1 / 235402 MGIID:1915522 Length:647 Species:Mus musculus


Alignment Length:588 Identity:123/588 - (20%)
Similarity:195/588 - (33%) Gaps:217/588 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPIWIPLLALL------AITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGN 62
            |..|.|:|.|:      .....|||.   |:.....:.|.|..::...:|||:...|::|:...|
Mouse    47 LACWQPILLLVLGSVLSGSATGCPPR---CECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKN 108

  Fly    63 ALQVLQSERFLRM----------------------DLLNLQKIYLSRNQLIRIHEKAFRGLTNLV 105
            .::.|..:.|...                      :|.||:.:.|..|:|..|....|.||:||.
Mouse   109 RIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLT 173

  Fly   106 ELDLSENALQNVPSETFQDYSSLMRLSLSGNP--------------------------------- 137
            :||:|||.:..:....|||..:|..|.:..|.                                 
Mouse   174 KLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEAL 238

  Fly   138 ----------IRELKTSAFRHLSF-----------------------------LTTLELSNCQVE 163
                      :|.|..:|.|..||                             ||:|.:::|.:.
Mouse   239 SHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLT 303

  Fly   164 RIENEAFVGMDNLEWLRLDGNRIGFIQGT--HIL-----------------PKSLHGIS------ 203
            .:...|...:..|.:|.|..|.||.|:|:  |.|                 |.:..|::      
Mouse   304 AVPYLAVRHLVYLRFLNLSYNPIGTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLN 368

  Fly   204 ------------------------LHSNRWNCDCRLLDI--HFWLVNYNTPLAEEPKCMEPARLK 242
                                    |.||...||||||.:  ..|.:|:|   .::|.|..|..::
Mouse   369 VSGNQLTTLEESAFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFN---RQQPTCATPEFVQ 430

  Fly   243 GQVIKSLQREQLACLPEVSPQSSYT--------------EVSEGRNMSITCLVRAIPEPKVLWLF 293
            |:..|.        .|:|...:.:|              .|.||..:...|.....|.|.:|||.
Mouse   431 GKEFKD--------FPDVLLPNYFTCRRAHIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLS 487

  Fly   294 NGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGT------ 352
            ..:.:.  |...|..:..:.|.|:.|..|:            .:||||:.|:..|..|.      
Mouse   488 PRKHLV--SAKSNGRLTVFPDGTLEVRYAQ------------VQDNGTYLCIAANAGGNDSMPAH 538

  Fly   353 ----TFS-------NYTLRVIIKEP------PVVNEVSFPRDYMNYIVASSAGG-GIIFVVLLCT 399
                ::|       |.|...|..:|      .....|.||.|....|:|::.|. ..:.|||.|.
Mouse   539 LHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCL 603

  Fly   400 IVV 402
            :::
Mouse   604 VLL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 5/17 (29%)
leucine-rich repeat 54..79 CDD:275380 6/46 (13%)
LRR_8 79..138 CDD:290566 22/101 (22%)
LRR_RI <80..187 CDD:238064 36/178 (20%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
leucine-rich repeat 104..127 CDD:275380 9/22 (41%)
LRR_8 126..186 CDD:290566 18/131 (14%)
leucine-rich repeat 128..151 CDD:275380 7/65 (11%)
leucine-rich repeat 152..175 CDD:275380 5/22 (23%)
leucine-rich repeat 176..198 CDD:275380 11/40 (28%)
TPKR_C2 207..256 CDD:301599 15/50 (30%)
I-set 258..361 CDD:254352 28/133 (21%)
Ig_2 263..361 CDD:290606 26/128 (20%)
Lingo1XP_006511149.1 LRRNT 68..102 CDD:214470 10/36 (28%)
LRR <93..398 CDD:227223 57/304 (19%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 1/22 (5%)
LRR_8 147..206 CDD:338972 22/58 (38%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..219 CDD:275380 12/46 (26%)
leucine-rich repeat 220..243 CDD:275380 0/22 (0%)
leucine-rich repeat 244..291 CDD:275380 6/46 (13%)
leucine-rich repeat 292..315 CDD:275380 5/22 (23%)
leucine-rich repeat 316..339 CDD:275380 10/22 (45%)
leucine-rich repeat 340..363 CDD:275380 2/22 (9%)
leucine-rich repeat 364..384 CDD:275380 0/19 (0%)
PCC 368..>448 CDD:188093 19/90 (21%)
Ig 466..541 CDD:386229 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8825
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.