DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and LINGO2

DIOPT Version :10

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_689783.1 Gene:LINGO2 / 158038 HGNCID:21207 Length:606 Species:Homo sapiens


Alignment Length:596 Identity:121/596 - (20%)
Similarity:203/596 - (34%) Gaps:231/596 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGLPIWIPLLALLAI------TAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFS 60
            :.:..|.|.|.|..:      |..||..   |:.....::|.|..::|..:|||:...|::|:.|
Human     4 TAISCWQPFLGLAVVLIFMGSTIGCPAR---CECSAQNKSVSCHRRRLIAIPEGIPIETKILDLS 65

  Fly    61 GNALQVLQSERFLRMDLL----------------------NLQKIYLSRNQLIRIHEKAFRGLTN 103
            .|.|:.:..|.|:...||                      ||:.:.|..|:|..:....|.||:|
Human    66 KNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSN 130

  Fly   104 LVELDLSENA------------------------------------------------LQNVPSE 120
            |.:||:|||.                                                |..||:|
Human   131 LTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTE 195

  Fly   121 TFQDYSSLM-----RLSLSGNPIRELK-----------------------------TS------- 144
            ......||:     .|:::..|:...|                             ||       
Human   196 ALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTN 260

  Fly   145 -------AFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFI-----QGTHIL-- 195
                   ||:||.:||.|.||...:..||...|..:..|:.|.:.|.::..|     ||...|  
Human   261 LSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRV 325

  Fly   196 ------------------PKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTPL---AEEPKCMEPA 239
                              |::|..:|:::|...||||||    |::.....|   .::|.|..|.
Human   326 LNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLL----WILQRQPTLQFGGQQPMCAGPD 386

  Fly   240 RLKGQVIKSLQREQLA----C-LPEVSPQS-SYTEVSEGRNMSITCLVRAIPEPKVLWL------ 292
            .::.:..|......|:    | .|::..:. .:..|.||:.:.:.|.....|:|.:.|:      
Human   387 TIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECSADGDPQPVISWVTPRRRF 451

  Fly   293 ----FNGQ--VMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAG 351
                .||:  |:.              |.|:.:..|::            :|:|.:.|:..|.||
Human   452 ITTKSNGRATVLG--------------DGTLEIRFAQD------------QDSGMYVCIASNAAG 490

  Fly   352 TTFSNYTLRVIIK-----------EPPV------------VNEVSFPRDYMNYIVASSAGGGIIF 393
            .  ..:|..:.:|           ..|:            .|..:|..| :..|:.|:|.|...|
Human   491 N--DTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLD-LKTILVSTAMGCFTF 552

  Fly   394 --VVLLCTIVV 402
              |||.|.:::
Human   553 LGVVLFCFLLL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 LRR <34..>204 CDD:443914 62/312 (20%)
leucine-rich repeat 34..52 CDD:275380 6/17 (35%)
leucine-rich repeat 54..79 CDD:275380 9/46 (20%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
leucine-rich repeat 104..127 CDD:275380 10/70 (14%)
leucine-rich repeat 128..151 CDD:275380 10/70 (14%)
leucine-rich repeat 152..175 CDD:275380 8/22 (36%)
leucine-rich repeat 176..198 CDD:275380 8/46 (17%)
LRRCT 207..256 CDD:214507 14/55 (25%)
Ig_3 258..348 CDD:464046 17/102 (17%)
LINGO2NP_689783.1 LRRNT 27..60 CDD:214470 9/35 (26%)
leucine-rich repeat 39..57 CDD:275380 6/17 (35%)
LRR 48..>340 CDD:443914 58/291 (20%)
LRR 1 58..79 7/20 (35%)
leucine-rich repeat 59..82 CDD:275380 7/22 (32%)
LRR 2 82..103 2/20 (10%)
leucine-rich repeat 83..106 CDD:275380 1/22 (5%)
LRR 3 106..127 6/20 (30%)
leucine-rich repeat 107..130 CDD:275380 7/22 (32%)
LRR 4 130..151 7/20 (35%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
LRR 5 154..175 0/20 (0%)
leucine-rich repeat 155..178 CDD:275380 0/22 (0%)
LRR 6 178..199 4/20 (20%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)
LRR 7 202..223 4/20 (20%)
leucine-rich repeat 203..250 CDD:275380 4/46 (9%)
LRR 8 226..247 0/20 (0%)
LRR 9 250..271 4/20 (20%)
leucine-rich repeat 251..274 CDD:275380 6/22 (27%)
LRR 10 274..295 8/20 (40%)
leucine-rich repeat 275..298 CDD:275380 8/22 (36%)
LRR 11 298..319 4/20 (20%)
leucine-rich repeat 299..322 CDD:275380 6/22 (27%)
LRR 12 322..343 1/20 (5%)
leucine-rich repeat 323..343 CDD:275380 1/19 (5%)
LRRCT 355..408 CDD:214507 14/56 (25%)
Ig 411..500 CDD:472250 20/116 (17%)
Ig strand B 428..432 CDD:409353 0/3 (0%)
Ig strand C 441..445 CDD:409353 0/3 (0%)
Ig strand E 466..470 CDD:409353 1/3 (33%)
Ig strand F 480..485 CDD:409353 1/4 (25%)
Ig strand G 493..496 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.