DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and CHADL

DIOPT Version :10

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_054181131.1 Gene:CHADL / 150356 HGNCID:25165 Length:771 Species:Homo sapiens


Alignment Length:393 Identity:87/393 - (22%)
Similarity:142/393 - (36%) Gaps:133/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPIWIPLLALLAITAA-------CPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSG 61
            :|:.:|||.||.:..|       | |:.|:|  ...::.|.|..|.|:.:|:.:...||.|:..|
Human    10 VPLVLPLLVLLLLAPARQAAAQRC-PQACIC--DNSRRHVACRYQNLTEVPDAIPELTQRLDLQG 71

  Fly    62 NALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDYS 126
            |.|:|:.:..|  ..:.:|..:.|...::..:.|.|||||..|:.|:|:.|.|:.:|.|......
Human    72 NLLKVIPAAAF--QGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALDGLG 134

  Fly   127 SLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQG 191
            ||.||.|.||.:.||:...|..|..|.||.|::..:..:...||.|:..:.||||..|.:..   
Human   135 SLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSV--- 196

  Fly   192 THILPKSLHG------ISLHSNR------------------------------------------ 208
              :.|::|.|      :|||.|.                                          
Human   197 --LAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLREL 259

  Fly   209 -----------------------------------------------------WNCDCRLLDIHF 220
                                                                 | |.|:...:..
Human   260 LLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPGQLRRLRLQGNPLW-CGCQARPLLE 323

  Fly   221 WLVNYNTPLAEEPKCMEPARLKGQVIKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIP 285
            ||.  ...:..:..|..|.||:|:.:.:|:...|.|..:.:.:..  |:.|          ||:.
Human   324 WLA--RARVRSDGACQGPRRLRGEALDALRPWDLRCPGDAAQEEE--ELEE----------RAVA 374

  Fly   286 EPK 288
            .|:
Human   375 GPR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 LRR <34..>204 CDD:443914 54/175 (31%)
leucine-rich repeat 34..52 CDD:275380 5/17 (29%)
leucine-rich repeat 54..79 CDD:275380 8/24 (33%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
leucine-rich repeat 128..151 CDD:275380 10/22 (45%)
leucine-rich repeat 152..175 CDD:275380 7/22 (32%)
leucine-rich repeat 176..198 CDD:275380 6/21 (29%)
LRRCT 207..256 CDD:214507 13/143 (9%)
Ig_3 258..348 CDD:464046 5/31 (16%)
CHADLXP_054181131.1 LRRNT 33..65 CDD:214470 9/34 (26%)
leucine-rich repeat 44..62 CDD:275380 5/17 (29%)
leucine-rich repeat 64..87 CDD:275380 8/24 (33%)
LRR_8 65..146 CDD:404697 29/82 (35%)
leucine-rich repeat 88..135 CDD:275380 15/46 (33%)
LRR <128..>312 CDD:443914 31/188 (16%)
leucine-rich repeat 136..159 CDD:275380 10/22 (45%)
leucine-rich repeat 160..183 CDD:275380 7/22 (32%)
leucine-rich repeat 184..207 CDD:275380 8/27 (30%)
leucine-rich repeat 208..231 CDD:275380 4/22 (18%)
leucine-rich repeat 232..255 CDD:275380 0/22 (0%)
leucine-rich repeat 256..279 CDD:275380 0/22 (0%)
LRRNT 395..429 CDD:214470
leucine-rich repeat 410..426 CDD:275380
leucine-rich repeat 427..450 CDD:275380
LRR <445..>677 CDD:443914
leucine-rich repeat 451..474 CDD:275380
leucine-rich repeat 475..498 CDD:275380
leucine-rich repeat 499..522 CDD:275380
leucine-rich repeat 523..546 CDD:275380
leucine-rich repeat 547..570 CDD:275380
leucine-rich repeat 571..594 CDD:275380
leucine-rich repeat 595..619 CDD:275380
leucine-rich repeat 620..644 CDD:275380
LRRCT 675..723 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.