Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026862.1 | Gene: | LRRC17 / 10234 | HGNCID: | 16895 | Length: | 441 | Species: | Homo sapiens |
Alignment Length: | 259 | Identity: | 62/259 - (23%) |
---|---|---|---|
Similarity: | 95/259 - (36%) | Gaps: | 81/259 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 QTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAF 98
Fly 99 RGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVE 163
Fly 164 RIENEAFVGMDNLEWLRLDGNRIGFIQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTP 228
Fly 229 LAEEPKCMEPARLK----GQVIKSLQRE----QLACLPEVSPQSSYTEVSEGRNMSITCLVRAI 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 5/17 (29%) |
leucine-rich repeat | 54..79 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 79..138 | CDD:290566 | 24/58 (41%) | ||
LRR_RI | <80..187 | CDD:238064 | 31/106 (29%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 12/22 (55%) | ||
LRR_8 | 126..186 | CDD:290566 | 8/59 (14%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 152..175 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 3/21 (14%) | ||
TPKR_C2 | 207..256 | CDD:301599 | 14/56 (25%) | ||
I-set | 258..361 | CDD:254352 | 5/27 (19%) | ||
Ig_2 | 263..361 | CDD:290606 | 3/22 (14%) | ||
LRRC17 | NP_001026862.1 | leucine-rich repeat | 63..81 | CDD:275380 | |
LRR 1 | 82..103 | ||||
LRR_8 | 84..141 | CDD:290566 | |||
leucine-rich repeat | 84..106 | CDD:275380 | |||
LRR_4 | 105..146 | CDD:289563 | |||
LRR 2 | 106..127 | ||||
leucine-rich repeat | 107..130 | CDD:275380 | |||
LRR 3 | 130..151 | ||||
leucine-rich repeat | 131..154 | CDD:275380 | |||
leucine-rich repeat | 155..244 | CDD:275380 | |||
leucine-rich repeat | 249..269 | CDD:275380 | 5/18 (28%) | ||
LRR_RI | <267..>351 | CDD:238064 | 38/156 (24%) | ||
LRR 4 | 269..290 | 5/22 (23%) | |||
leucine-rich repeat | 270..293 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 272..328 | CDD:290566 | 24/57 (42%) | ||
LRR 5 | 293..314 | 8/20 (40%) | |||
LRR_4 | 294..332 | CDD:289563 | 21/43 (49%) | ||
leucine-rich repeat | 294..317 | CDD:275380 | 10/22 (45%) | ||
LRR 6 | 317..340 | 13/46 (28%) | |||
leucine-rich repeat | 318..341 | CDD:275380 | 14/46 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |