DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and slitrk3

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_002933279.1 Gene:slitrk3 / 100127669 XenbaseID:XB-GENE-964617 Length:885 Species:Xenopus tropicalis


Alignment Length:349 Identity:94/349 - (26%)
Similarity:151/349 - (43%) Gaps:51/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGLPIWIPLLALLAITAACP------------P--EVCVCKWKGGKQTVECGGQQLSNLPEGMD 51
            :.|..:||.||:.:|:....|            |  :.|.|:.|.....:.|..:..:|:.:..:
 Frog    10 LKGRMLWIILLSTIALAWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIYCDNKGFTNISQITE 74

  Fly    52 PGTQ--VLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENAL 114
            ..::  .|....|:::.|.:..||.::  |...|.:..|.|..|...||.||..|..|.|.||.|
 Frog    75 YWSRPFKLYLQRNSMRKLYTNSFLHLN--NAVSINMGNNALQDIQAGAFNGLKVLKRLYLHENKL 137

  Fly   115 QNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWL 179
            .:..::||....||..|....|.|:.:::.|||:|:.|..|.|::..:..:....|..: :|..|
 Frog   138 DSFKNDTFLGLESLEYLQADYNVIKRIESGAFRYLNKLRVLILNDNHIPLLPTNLFKSV-SLTHL 201

  Fly   180 RLDGNR--IGFIQG--THILPKSLHGISLHSNRWNCDCRLLDIHFWL--VNYNTPLAEEPKCMEP 238
            .|.|||  |.|.:|  .|| .:||..|.|..|.|||.|.:|.:..||  :.| |.|..:..|..|
 Frog   202 DLRGNRLKILFYKGMLDHI-GRSLMEIQLAENPWNCTCEILQLKNWLERIPY-TVLVGDITCESP 264

  Fly   239 ARLKGQVIKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSNDSL 303
            ....|:.::.::|.:|.  |.::  .|..|:|.|        :..||..|.    |.......|:
 Frog   265 FHFHGKDLRDIKRSKLC--PSLT--ESEAEISWG--------IPQIPSSKE----NAWPTKPSSM 313

  Fly   304 MDNLHMYYYIDETIGVSGAEEKRS 327
            :.:.|        :..|..|.|.|
 Frog   314 LSSSH--------VTASSVEYKSS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 2/17 (12%)
leucine-rich repeat 54..79 CDD:275380 5/26 (19%)
LRR_8 79..138 CDD:290566 21/58 (36%)
LRR_RI <80..187 CDD:238064 35/108 (32%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
LRR_8 126..186 CDD:290566 19/61 (31%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 4/22 (18%)
leucine-rich repeat 176..198 CDD:275380 11/25 (44%)
TPKR_C2 207..256 CDD:301599 16/50 (32%)
I-set 258..361 CDD:254352 15/70 (21%)
Ig_2 263..361 CDD:290606 14/65 (22%)
slitrk3XP_002933279.1 LRR_8 81..137 CDD:338972 19/57 (33%)
leucine-rich repeat 81..102 CDD:275380 5/22 (23%)
leucine-rich repeat 103..126 CDD:275380 8/22 (36%)
LRR_8 127..185 CDD:338972 20/57 (35%)
leucine-rich repeat 127..150 CDD:275380 8/22 (36%)
leucine-rich repeat 151..174 CDD:275380 8/22 (36%)
leucine-rich repeat 175..197 CDD:275380 4/22 (18%)
leucine-rich repeat 198..283 CDD:275380 31/88 (35%)
leucine-rich repeat 224..236 CDD:275378 5/11 (45%)
LRRCT 232..>270 CDD:214507 13/38 (34%)
LRR <388..>562 CDD:227223
leucine-rich repeat 389..409 CDD:275380
leucine-rich repeat 410..433 CDD:275380
leucine-rich repeat 434..457 CDD:275380
LRR_8 457..516 CDD:338972
leucine-rich repeat 458..481 CDD:275380
leucine-rich repeat 482..505 CDD:275380
leucine-rich repeat 506..528 CDD:275380
leucine-rich repeat 529..553 CDD:275380
LRRCT 562..>597 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.