DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and slitrk3b

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_001346135.2 Gene:slitrk3b / 100007758 ZFINID:ZDB-GENE-070912-352 Length:882 Species:Danio rerio


Alignment Length:280 Identity:83/280 - (29%)
Similarity:125/280 - (44%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IWIPLLALLAITAACP------------P--EVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQV 56
            :|:.||:.:|:....|            |  |.|.|:.|.|...|.|..:..:|:       :||
Zfish    11 LWVTLLSTIALGWTTPIPLLDDSEEIDEPCFEPCYCEVKEGLFHVHCDSKGFTNI-------SQV 68

  Fly    57 ---------LNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSEN 112
                     |....|:|:.|....||.::  |...|.|..|.|..||..||.||.:|..|.|.||
Zfish    69 SQSWLRPFKLYLQKNSLRKLYFNSFLHLN--NAVAINLGNNALQDIHVGAFNGLGSLKRLYLHEN 131

  Fly   113 ALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLE 177
            .|:...::||....||..|....|.|:.:.:.|||:|..|..|.|::..:..:....|..: :|.
Zfish   132 KLEVFRNDTFLGLESLEYLQADYNVIKRIDSGAFRNLHKLRVLILNDNLIPVLPAFLFRSV-SLT 195

  Fly   178 WLRLDGNRIGFIQGTHILP---KSLHGISLHSNRWNCDCRLLDIHFWL--VNYNTPLAEEPKCME 237
            .|.|.|||:..:....||.   :||..|.|..|.|||.|.::.:..||  :.| |.:..|..|..
Zfish   196 HLDLRGNRLKTLPYKGILEYIGRSLMEIQLEENPWNCICDIIQLQAWLERIPY-TAVVGEITCEY 259

  Fly   238 PARLKGQVIKSLQREQLACL 257
            |..|.|:.::.::|.:|..|
Zfish   260 PFHLHGKDLREIKRSELCPL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 3/17 (18%)
leucine-rich repeat 54..79 CDD:275380 8/33 (24%)
LRR_8 79..138 CDD:290566 23/58 (40%)
LRR_RI <80..187 CDD:238064 37/106 (35%)
leucine-rich repeat 80..103 CDD:275380 10/22 (45%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
LRR_8 126..186 CDD:290566 18/59 (31%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 4/22 (18%)
leucine-rich repeat 176..198 CDD:275380 8/24 (33%)
TPKR_C2 207..256 CDD:301599 16/50 (32%)
I-set 258..361 CDD:254352 83/280 (30%)
Ig_2 263..361 CDD:290606
slitrk3bXP_001346135.2 leucine-rich repeat 52..72 CDD:275380 5/26 (19%)
leucine-rich repeat 73..98 CDD:275380 6/26 (23%)
LRR_8 77..133 CDD:290566 22/57 (39%)
leucine-rich repeat 99..122 CDD:275380 10/22 (45%)
LRR_RI <102..206 CDD:238064 37/104 (36%)
LRR_8 122..181 CDD:290566 20/58 (34%)
leucine-rich repeat 123..146 CDD:275380 8/22 (36%)
leucine-rich repeat 147..170 CDD:275380 8/22 (36%)
leucine-rich repeat 171..193 CDD:275380 4/22 (18%)
TPKR_C2 228..278 CDD:301599 16/50 (32%)
leucine-rich repeat 381..401 CDD:275380
LRR_RI 385..>555 CDD:238064
LRR_8 401..460 CDD:290566
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 426..449 CDD:275380
LRR_8 448..508 CDD:290566
LRR_4 448..489 CDD:289563
leucine-rich repeat 450..473 CDD:275380
leucine-rich repeat 474..497 CDD:275380
LRR_8 496..555 CDD:290566
leucine-rich repeat 498..520 CDD:275380
leucine-rich repeat 521..545 CDD:275380
LRRCT 554..604 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.