DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlg5 and CYTIP

DIOPT Version :9

Sequence 1:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:397 Identity:75/397 - (18%)
Similarity:126/397 - (31%) Gaps:125/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 MAIRDSEKIKKQKD------EAQKKIDLLKEQMEQQERQNLDSNASGSRRSFRPSSYEGEDLLEV 442
            :.:.|:.:|:...|      ..:|::.|        .|.:..|:.|.|:|.......:..:....
Human    34 LTMDDNRRIQMLADTVATLPRGRKQLAL--------TRSSSLSDFSWSQRKLVTVEKQDNETFGF 90

  Fly   443 ELSGYEHTSDLGIILDDSNKRKLVCGVTSSSPA-CGKLKINDVICKVNNLDCQSLSKRMVLDEIR 506
            |:..|...:....   .|....|:|.:...||| |..|:..||:..:|.:..:..:.:.|:|.||
Human    91 EIQSYRPQNQNAC---SSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIR 152

  Fly   507 ACAP-------RSLLLVSRTR-HSKRHAYSVQLKTRDRDCPHGLQLDMGVFIAKIEQNSLAFYEP 563
            :...       ...:::.||. .:|.......||.:                 .:|..||...|.
Human   153 SSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQK-----------------WVEYRSLQLQEH 200

  Fly   564 ELDVGDRVLSINNKSMDSVQSIEEVMQLMNDPRSDGLNLFALKYVQDQLP-PGMT---------- 617
            .|..||.....:.::||                .|.|:||.      .|| ||..          
Human   201 RLLHGDAANCPSLENMD----------------LDELSLFG------PLPGPGPALVDRNRLSSE 243

  Fly   618 ------TSSAQTDSIDSMQHVSSAGGGGGSGPSSATKHPSRFAEFFFRKLKFSKPGTPEDN--FE 674
                  .||...||.|..|...|.....|:                     ||:..:.:|.  ..
Human   244 SSCKSWLSSMTMDSEDGYQTCVSEDSSRGA---------------------FSRQTSTDDECFIP 287

  Fly   675 QEHDDAIAALDSVLSENSSEKSKENLFNRKKRTKK---EKEASKSMGTWPRTNISHENPTGTMRG 736
            :|.||.:        ..||.:...::.|....:..   |...|...||.||.         :.:|
Human   288 KEGDDFL--------RRSSSRRNRSISNTSSGSMSPLWEGNLSSMFGTLPRK---------SRKG 335

  Fly   737 NEKKRAL 743
            :.:|:.|
Human   336 SVRKQLL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007 5/29 (17%)
PDZ_signaling 439..516 CDD:238492 17/84 (20%)
PDZ_signaling 533..592 CDD:238492 9/58 (16%)
PDZ_signaling 1290..1369 CDD:238492
PDZ_signaling 1497..1576 CDD:238492
SH3_DLG5 1594..1657 CDD:212794
Guanylate_kin 1737..1904 CDD:279019
NK <1773..1905 CDD:302627
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 17/87 (20%)
Interaction with CYTH1 166..188 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.