DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlg5 and CG11811

DIOPT Version :9

Sequence 1:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster
Sequence 2:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster


Alignment Length:213 Identity:48/213 - (22%)
Similarity:86/213 - (40%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1692 SSSRDSTEIASFSNTQLSFFPDLGLLNDDGGALSYQRVELLDSPIRRPVLIIGPL---SECLMVR 1753
            |||..|:..||.::.:::                        :|..||:::.||.   ...|:.|
  Fly    14 SSSSSSSAAASLTSKKMT------------------------APGPRPLVLCGPSGSGKSTLLKR 54

  Fly  1754 LTIDFSNLFKLCEVTAMDCSQEAMEEGLK----ENIFVDYRRRGNKF----ECT-----TVEAIS 1805
            |..:|.:.|...........:|..|.|:.    |...::....|::|    |.|     |.:|..
  Fly    55 LFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAV 119

  Fly  1806 NACKNDRRHCILDVSISAVERLQRLQIYPIVLLLRFKSAKQI-RDIRDFGTDKISAKAAKEMYER 1869
            ...:...|.||||:....||:::|..:.||::.....|.|:: |.:|..|:: .....:|.:  .
  Fly   120 REIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSE-TEESLSKRL--N 181

  Fly  1870 AMKLETDYKQYISAVIPG 1887
            |.::|.||     .:.||
  Fly   182 AAQVELDY-----GLTPG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007
PDZ_signaling 439..516 CDD:238492
PDZ_signaling 533..592 CDD:238492
PDZ_signaling 1290..1369 CDD:238492
PDZ_signaling 1497..1576 CDD:238492
SH3_DLG5 1594..1657 CDD:212794
Guanylate_kin 1737..1904 CDD:279019 41/168 (24%)
NK <1773..1905 CDD:302627 32/129 (25%)
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 41/169 (24%)
guanyl_kin 36..216 CDD:213788 41/167 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.