DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlg5 and CG15617

DIOPT Version :9

Sequence 1:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:161 Identity:43/161 - (26%)
Similarity:59/161 - (36%) Gaps:55/161 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1531 SPSDHA---GIRKGDQILEYNGVDLSGVTAEQAANEISKLTDTVTMLVQNKLHTLKQIKDEPGDS 1592
            ||:..|   |:|.||:|.:.|.|....:|..:|.....|.:..|.:                   
  Fly    63 SPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRV------------------- 108

  Fly  1593 FYIRVGFDRTGELNED---DLRFVKDEVLYVDNTVFNGTFGLWRAWKLDAMGHRK------ECGI 1648
             |:|...|..||  ||   |..|...:....|.|....||    .|.    ..||      .|.:
  Fly   109 -YVRGDDDAPGE--EDWTCDCWFKPRKPWRRDFTPIQWTF----PWN----DRRKPVYKESNCFM 162

  Fly  1649 IPSQMKVEEELRSGEVVDCDTGTARRGSTSA 1679
            :||  |:||::|           |||.:|||
  Fly   163 VPS--KMEEKIR-----------ARRAATSA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007
PDZ_signaling 439..516 CDD:238492
PDZ_signaling 533..592 CDD:238492
PDZ_signaling 1290..1369 CDD:238492
PDZ_signaling 1497..1576 CDD:238492 14/47 (30%)
SH3_DLG5 1594..1657 CDD:212794 20/71 (28%)
Guanylate_kin 1737..1904 CDD:279019
NK <1773..1905 CDD:302627
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.