| Sequence 1: | NP_609505.1 | Gene: | Dlg5 / 34573 | FlyBaseID: | FBgn0032363 | Length: | 1916 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006246539.1 | Gene: | Guk1 / 303179 | RGDID: | 1309638 | Length: | 266 | Species: | Rattus norvegicus |
| Alignment Length: | 195 | Identity: | 36/195 - (18%) |
|---|---|---|---|
| Similarity: | 80/195 - (41%) | Gaps: | 33/195 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1738 RPVLIIGPL---SECLMVRLTIDFSNLFKLC-----------EVTAMD---CSQEAMEEGLKENI 1785
Fly 1786 FVDYRRRGNKFECTTVEAISNACKNDRRHCILDVSISAVERLQRLQIYPIVLLLRFKSAKQIRDI 1850
Fly 1851 RDFGTDKISAKAAKEMYERAMKLETDYKQYISAVIPGV--------SIKHMCTQIKDAVDKEQDK 1907
Fly 1908 1907 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dlg5 | NP_609505.1 | AAA_23 | <165..333 | CDD:290211 | |
| CENP-F_leu_zip | 229..360 | CDD:287450 | |||
| DUF1090 | <326..408 | CDD:284007 | |||
| PDZ_signaling | 439..516 | CDD:238492 | |||
| PDZ_signaling | 533..592 | CDD:238492 | |||
| PDZ_signaling | 1290..1369 | CDD:238492 | |||
| PDZ_signaling | 1497..1576 | CDD:238492 | |||
| SH3_DLG5 | 1594..1657 | CDD:212794 | |||
| Guanylate_kin | 1737..1904 | CDD:279019 | 34/190 (18%) | ||
| NK | <1773..1905 | CDD:302627 | 24/139 (17%) | ||
| Guk1 | XP_006246539.1 | Guanylate_kin | 71..256 | CDD:279019 | 34/190 (18%) |
| guanyl_kin | 73..255 | CDD:213788 | 34/189 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||