Sequence 1: | NP_609505.1 | Gene: | Dlg5 / 34573 | FlyBaseID: | FBgn0032363 | Length: | 1916 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343863.1 | Gene: | mics-1 / 179475 | WormBaseID: | WBGene00011890 | Length: | 293 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 51/206 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1406 PPARNSLFPLPMQPQAPSTRPGSRAPLSHQSIKDQSFTDSLENQSDISSSQDMPSSAATTTTTTA 1470
Fly 1471 SATSTVYDEEPKPSLPPPPASVPAETLRYVTLHMDKSKNLGIKLFGG-------NKVGIYVHDVA 1528
Fly 1529 VGSPSDHAGIRKGDQILEYNGVDLSGVTAEQAANEIS--KLTDTVTMLVQNKLHTLKQIKDEPGD 1591
Fly 1592 SFYIRVGFDRT 1602 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlg5 | NP_609505.1 | AAA_23 | <165..333 | CDD:290211 | |
CENP-F_leu_zip | 229..360 | CDD:287450 | |||
DUF1090 | <326..408 | CDD:284007 | |||
PDZ_signaling | 439..516 | CDD:238492 | |||
PDZ_signaling | 533..592 | CDD:238492 | |||
PDZ_signaling | 1290..1369 | CDD:238492 | |||
PDZ_signaling | 1497..1576 | CDD:238492 | 26/87 (30%) | ||
SH3_DLG5 | 1594..1657 | CDD:212794 | 4/9 (44%) | ||
Guanylate_kin | 1737..1904 | CDD:279019 | |||
NK | <1773..1905 | CDD:302627 | |||
mics-1 | NP_001343863.1 | PDZ_signaling | 71..145 | CDD:238492 | 23/75 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |