DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlg5 and LOC103911966

DIOPT Version :9

Sequence 1:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster
Sequence 2:XP_009305280.2 Gene:LOC103911966 / 103911966 -ID:- Length:191 Species:Danio rerio


Alignment Length:159 Identity:63/159 - (39%)
Similarity:94/159 - (59%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1594 YIRVGFDRTGELNEDDLRFVKDEVLYVDNTVFNGTFGLWRAWKLDAMGHRKECGIIPSQ-MKVEE 1657
            :.|..||..|: :|.:|.|.||::||||:|:..|.||.|.||:||....:...|.:||: |..::
Zfish     6 FFRALFDHVGD-SEQELSFKKDDILYVDDTLPRGNFGYWLAWQLDENAQKLMRGHVPSKCMMDQD 69

  Fly  1658 ELRSGEVVD--CDTGTARRGSTSARRSFFRRK-KNQRSSSRDSTEIASFSNTQLSFFPDLGLLND 1719
            ..|...|.|  .::|:.:..|.:||||||||| |::||:|:|..:..:.........|.|    :
Zfish    70 SQRRYSVTDGKDESGSGKTLSAAARRSFFRRKLKHKRSTSKDGRDAPAADAISTDSMPYL----E 130

  Fly  1720 DGGALSYQRVELLDSPIRRPVLIIGPLSE 1748
            |..:.:||||..::|..||||||:|||.|
Zfish   131 DCVSPAYQRVLKVESTNRRPVLILGPLVE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007
PDZ_signaling 439..516 CDD:238492
PDZ_signaling 533..592 CDD:238492
PDZ_signaling 1290..1369 CDD:238492
PDZ_signaling 1497..1576 CDD:238492
SH3_DLG5 1594..1657 CDD:212794 26/63 (41%)
Guanylate_kin 1737..1904 CDD:279019 10/12 (83%)
NK <1773..1905 CDD:302627
LOC103911966XP_009305280.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123652at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.