Sequence 1: | NP_609505.1 | Gene: | Dlg5 / 34573 | FlyBaseID: | FBgn0032363 | Length: | 1916 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189476.1 | Gene: | SYNJ2BP-COX16 / 100529257 | HGNCID: | 48350 | Length: | 191 | Species: | Homo sapiens |
Alignment Length: | 208 | Identity: | 51/208 - (24%) |
---|---|---|---|
Similarity: | 84/208 - (40%) | Gaps: | 37/208 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1279 NVPADFLCPGDLRRVTIDKRDKSLGITI------QCNNNGGGIFVSTVADKSTAMRAG-LQVGDQ 1336
Fly 1337 LLEVCGINMRAATQEIAANVLRQCGDSFTMLVQYNPEKFPSIEYEGAHNLEPES-PINHSGSPTP 1400
Fly 1401 RNSPRPPARNSLFPLP-MQPQAPSTRPGSRAPL--SHQSIKDQSFTDSLEN--------QSDISS 1454
Fly 1455 SQDMPSSAATTTT 1467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlg5 | NP_609505.1 | AAA_23 | <165..333 | CDD:290211 | |
CENP-F_leu_zip | 229..360 | CDD:287450 | |||
DUF1090 | <326..408 | CDD:284007 | |||
PDZ_signaling | 439..516 | CDD:238492 | |||
PDZ_signaling | 533..592 | CDD:238492 | |||
PDZ_signaling | 1290..1369 | CDD:238492 | 21/85 (25%) | ||
PDZ_signaling | 1497..1576 | CDD:238492 | |||
SH3_DLG5 | 1594..1657 | CDD:212794 | |||
Guanylate_kin | 1737..1904 | CDD:279019 | |||
NK | <1773..1905 | CDD:302627 | |||
SYNJ2BP-COX16 | NP_001189476.1 | PDZ_signaling | 13..97 | CDD:238492 | 21/83 (25%) |
DegQ | <16..77 | CDD:223343 | 18/60 (30%) | ||
COX16 | <133..173 | CDD:290843 | 9/40 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |