DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz4 and spz6

DIOPT Version :9

Sequence 1:NP_609504.2 Gene:spz4 / 34572 FlyBaseID:FBgn0032362 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_611961.1 Gene:spz6 / 37956 FlyBaseID:FBgn0035056 Length:425 Species:Drosophila melanogaster


Alignment Length:425 Identity:84/425 - (19%)
Similarity:124/425 - (29%) Gaps:147/425 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GTAPPLHEKPESETDIVEIQPSPES--------NSVYEVVSPSVLSTTSTAKPSSAAGENIQIID 279
            |.:.|..:.|   :|..|.|| ||.        |:|...|.|...:..:......|||:...:  
  Fly    19 GFSQPQQQSP---SDYGEEQP-PEGYYAFVESPNAVPPKVRPPPYTFVNAECKDVAAGKKSAV-- 77

  Fly   280 SPQLGLRNLSAEASPSQEPPTA----TTGKP--------TSVPKSTTPLPIRKRKPAETTTSAAS 332
                .:.|:..:.:..|.|...    ..|:|        .::...:..||:.|   |:.|.    
  Fly    78 ----SVHNICGDLNKGQIPKNPLGQNVLGEPYPFELIRNQTLKFLSKTLPVLK---ADDTL---- 131

  Fly   333 PKVSSTISTPTTTTATLLIRRNVTKYSPASVTTPVSFASLFSGTSSGLFS---------PERLRR 388
            |||:..|.......   |...|:.:..||..:|.|. .||..|..|..:|         .:..:|
  Fly   132 PKVTQIIRDEPVEQ---LDSNNIDRPYPAGGSTRVR-RSLPEGVESNEYSYFDPALDEEEQHKQR 192

  Fly   389 PLTTTSSTSAPASSP----PAGGT------PASSSTGSASKSGLLREGQLFQDAMKQEPVAVASN 443
            ........:|....|    ..||.      .....||.|:.:        ...|.::|.|.....
  Fly   193 DRNNQQRRAAEERKPRKFCDGGGVFCTLYRAIQGDTGGAAPA--------TPTAERREEVGPIRY 249

  Fly   444 LRGVNACPVKDEVVAPFWANNTRGEVLALLNLYPFEQY----VHWEKCTHEFKQMFCR---DGC- 500
            ......||.|.|...|.:|.|.:|....::.: |:|.|    |...:|.    |..|.   .|| 
  Fly   250 EGPPTPCPAKVEYATPVFAKNYQGAWRYVVQI-PYEGYFTQTVEVTRCI----QARCHYLDGGCL 309

  Fly   501 -------------------------------------RCEQQYRLHR-----------------L 511
                                                 :..|||...|                 .
  Fly   310 SSPRWVSLLVAEIFYPNAEDTVPTSSTTTQAPSVQDFQAYQQYLQKRAGVATASDGTSSGAAGPA 374

  Fly   512 LAYDPHNECRG----------IFSDWFRFPSSCIC 536
            ...|.|  |.|          ::.|||..|.||.|
  Fly   375 AQVDAH--CDGHDELGCFQVRLYYDWFLIPGSCKC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz4NP_609504.2 Spaetzle 448..536 CDD:292695 31/159 (19%)
spz6NP_611961.1 Spaetzle 256..407 CDD:292695 31/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.