DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salm and YPR015C

DIOPT Version :9

Sequence 1:NP_723670.2 Gene:salm / 34569 FlyBaseID:FBgn0261648 Length:1365 Species:Drosophila melanogaster
Sequence 2:NP_015340.1 Gene:YPR015C / 856125 SGDID:S000006219 Length:247 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:58/239 - (24%)
Similarity:93/239 - (38%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 EEQEQVKQEDHRIEPRRTPSPSSEHRSPHHHRHSHMGYPPVVQPIQPAALMHPQ-----SSPGSQ 705
            |.....|:|.|      .|..||...:|.....:....||......|::|...:     |||.|.
Yeast    32 EVSNTTKREVH------LPPCSSIMHAPLTPEINQAALPPPAYHYAPSSLHQTEDPVWRSSPNSI 90

  Fly   706 SHLDHLPTPGQLPPREDFFAERFPLNFTTAKMLSPEHHSPVRSPAGGALPPGVPPPPHHHPHHMA 770
            .....:.||           :.|||.|...:...|.:.:...|....::||.:    .|......
Yeast    91 IFSPVIATP-----------QPFPLTFVERQSCCPIYSTAASSYTAQSVPPSM----QHFQEENH 140

  Fly   771 RSPFFNPIKHEMAALLPRPHSNDNSWENFIEVSNTCETM--KLKELMKNKKISDPNQCVVCDRVL 833
            |:     :.:|..: ||..|...|......:.....:.:  :|:.::|.:|     ||.:|.:|.
Yeast   141 RA-----VSNEQYS-LPNVHIGQNPGTLLSQTQTDLDLIQKQLRAVVKLRK-----QCPICGKVC 194

  Fly   834 SCKSALQMHYRTHTGERPFKC--RICGRAFTTKGNLKTHMAVHK 875
            |..|.|:.||..|||:.||||  ..|.::|..|.|:..|:..|:
Yeast   195 SRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
salmNP_723670.2 zf-C2H2 451..473 CDD:278523
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..490 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 826..846 CDD:275368 8/19 (42%)
zf-H2C2_2 838..863 CDD:290200 12/26 (46%)
zf-C2H2_2 854..922 CDD:289522 7/24 (29%)
C2H2 Zn finger 854..874 CDD:275368 6/21 (29%)
C2H2 Zn finger 886..906 CDD:275368
C2H2 Zn finger 1291..1311 CDD:275368
zf-H2C2_2 1303..1328 CDD:290200
C2H2 Zn finger 1319..1339 CDD:275368
YPR015CNP_015340.1 COG5048 <17..247 CDD:227381 58/239 (24%)
C2H2 Zn finger 187..207 CDD:275370 8/19 (42%)
C2H2 Zn finger 215..237 CDD:275370 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23233
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.