DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salm and YY1

DIOPT Version :9

Sequence 1:NP_723670.2 Gene:salm / 34569 FlyBaseID:FBgn0261648 Length:1365 Species:Drosophila melanogaster
Sequence 2:NP_003394.1 Gene:YY1 / 7528 HGNCID:12856 Length:414 Species:Homo sapiens


Alignment Length:414 Identity:87/414 - (21%)
Similarity:130/414 - (31%) Gaps:146/414 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 EHEQEMAECSEPEPEPLPLE------VRIKEERVEEQEQVKQEDHRIEPRRTPSPSSEHRSPHHH 676
            |...|:.|..|.|.|.:|:|      |..:||..::.|.....||      .......|...|||
Human    15 EMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDH------GGGGGHGHAGHHHH 73

  Fly   677 RHSHMGYPPVV--QPI---QPAALMHPQ---------------------SSPGSQSHLDHLPTPG 715
            .|.|..:||::  ||:   .|..:.|.|                     :..|.:..: .:|.|.
Human    74 HHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQI-LIPVPA 137

  Fly   716 QLPPREDFFAERF-------------------------------------------------PLN 731
            .....:|:..:..                                                 |.|
Human   138 PAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGN 202

  Fly   732 ----------------FTTAKMLSPE-----HHSPV-------RSP-------AGGALPP-GVPP 760
                            |:.....|.|     |.:.|       .||       .|..||| |:|.
Human   203 KKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPG 267

  Fly   761 PPHHHPHHMARSPFFNPIKHEMAALLPRPHSNDNSWENFIEVSNTCETM--KLKELMKNKKISDP 823
            .....|..:|          |.|.:.||....|::..........|..|  ....:.|:.....|
Human   268 IDLSDPKQLA----------EFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGP 322

  Fly   824 --NQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI--CGRAFTTKGNLKTHMAVHKIRPPMRNFH 884
              :.|..|.:.....|.|:.|...||||:||:|..  ||:.|:...||:||:.:|....|    :
Human   323 RVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRP----Y 383

  Fly   885 QCPV--CHKKYSNALVLQQHIRLH 906
            .||.  |:||::.:..|:.||..|
Human   384 VCPFDGCNKKFAQSTNLKSHILTH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
salmNP_723670.2 zf-C2H2 451..473 CDD:278523
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..490 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 826..846 CDD:275368 5/19 (26%)
zf-H2C2_2 838..863 CDD:290200 12/26 (46%)
zf-C2H2_2 854..922 CDD:289522 19/57 (33%)
C2H2 Zn finger 854..874 CDD:275368 8/21 (38%)
C2H2 Zn finger 886..906 CDD:275368 8/21 (38%)
C2H2 Zn finger 1291..1311 CDD:275368
zf-H2C2_2 1303..1328 CDD:290200
C2H2 Zn finger 1319..1339 CDD:275368
YY1NP_003394.1 Interaction with the SMAD1/SMAD4 complex 1..170 31/161 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..81 13/53 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..203 1/45 (2%)
Involved in nuclear matrix association 257..341 20/93 (22%)
COG5048 <268..407 CDD:227381 40/152 (26%)
Binding to DNA 295..414 34/117 (29%)
C2H2 Zn finger 298..320 CDD:275368 3/21 (14%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
Involved in repression of activated transcription 333..371 14/37 (38%)
C2H2 Zn finger 355..377 CDD:275368 8/21 (38%)
Involved in masking transactivation domain 371..397 9/29 (31%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.