DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salm and si:ch211-89o9.6

DIOPT Version :9

Sequence 1:NP_723670.2 Gene:salm / 34569 FlyBaseID:FBgn0261648 Length:1365 Species:Drosophila melanogaster
Sequence 2:XP_687655.4 Gene:si:ch211-89o9.6 / 559243 ZFINID:ZDB-GENE-030131-7155 Length:582 Species:Danio rerio


Alignment Length:432 Identity:100/432 - (23%)
Similarity:145/432 - (33%) Gaps:107/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   970 SESSQ------GDMDDNMDCGEDYDDDVSSEHLSNSNLEQ---EGDRSRS-------GDDFKSLL 1018
            :|:||      ||:..:       ||.||.  :.::||||   |.:...:       .|.::   
Zfish   163 TETSQTGEPGFGDVQKD-------DDQVSG--MQHTNLEQGKVEYEEPETIVIKEDLNDQWE--- 215

  Fly  1019 FEQKLRIDATGV----------VNTNPVRP------------------RSSASSHGHSVGSTS-- 1053
            ..|...|....|          ::|:|.:|                  :|...|.|....::|  
Zfish   216 ISQAQTITVQDVESNKDICSKRLSTSPTKPTVAPGTEKPIELEFSHFSKSGQKSWGQKSDTSSST 280

  Fly  1054 ---------APTSPSVHASSQVIKRSSSPARSEASQGALDLTPRAAPTSSSSSRSPLPKEK--PV 1107
                     |.:|||   |||..:..:..||...|...:.:|   |.:.|......:.|.:  |.
Zfish   281 GLQMNLQGTAESSPS---SSQQHQFQNFAARPNKSLTTIKIT---AVSGSEQVHKGIGKSRNSPT 339

  Fly  1108 SPPSLPRSPSGSSHASANILTSPLPPTVGIDCLPPGLQHHLQQQHQH----LMQQQAAVAAAAAA 1168
            :.|||....:....|...::..|..........|....|.....:|.    |:|.:...:...:.
Zfish   340 NQPSLTAEKTAIETADCLLIDKPAEHKTSFTHWPTQPSHSYSDSNQDEDCVLVQSETVTSIRNSK 404

  Fly  1169 QHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAAQRQTPPQARDQRQEGGPGAGPPP 1233
            ...........|...|:..||.....|          |....|.||....    ..|.|.|....
Zfish   405 SGQDGSSFTQTHPAAERPLREEERWNQ----------AGIFKQSQTDVSG----HIGRPEAIQKD 455

  Fly  1234 NPLMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQSVMPAAPFNPLAL-SGVRGSTTCGICYKT 1297
            .|...:...|.:.|          |.|.| :.|...|:  |.|..|..: .|.|.|..|..|.|.
Zfish   456 TPNRSSASYFTVIP----------QTMSN-LTQPGASL--AGPQLPKRMEKGRRRSYVCKYCGKA 507

  Fly  1298 FPCHSALEIHYRSHTKERPFKCSICDRGFTTKGNLKQHMLTH 1339
            ||..|.:..|.|.||.||||:|.||.:.|...||||:|...|
Zfish   508 FPGLSNVVAHQRVHTGERPFRCDICGKLFAEAGNLKKHQRVH 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
salmNP_723670.2 zf-C2H2 451..473 CDD:278523
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..490 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 826..846 CDD:275368
zf-H2C2_2 838..863 CDD:290200
zf-C2H2_2 854..922 CDD:289522
C2H2 Zn finger 854..874 CDD:275368
C2H2 Zn finger 886..906 CDD:275368
C2H2 Zn finger 1291..1311 CDD:275368 8/19 (42%)
zf-H2C2_2 1303..1328 CDD:290200 12/24 (50%)
C2H2 Zn finger 1319..1339 CDD:275368 9/19 (47%)
si:ch211-89o9.6XP_687655.4 COG5048 <364..>558 CDD:227381 55/213 (26%)
zf-C2H2 499..521 CDD:278523 8/21 (38%)
C2H2 Zn finger 501..521 CDD:275368 8/19 (42%)
zf-H2C2_2 517..537 CDD:290200 11/19 (58%)
C2H2 Zn finger 529..549 CDD:275368 9/19 (47%)
zf-H2C2_2 541..565 CDD:290200 5/9 (56%)
C2H2 Zn finger 557..574 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23233
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.