Sequence 1: | NP_723670.2 | Gene: | salm / 34569 | FlyBaseID: | FBgn0261648 | Length: | 1365 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524630.1 | Gene: | pho / 43819 | FlyBaseID: | FBgn0002521 | Length: | 520 | Species: | Drosophila melanogaster |
Alignment Length: | 280 | Identity: | 66/280 - (23%) |
---|---|---|---|
Similarity: | 99/280 - (35%) | Gaps: | 94/280 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 691 QPAALMHPQSSPGSQSHLDHLPTPGQLPPREDFFAERFPLNFTTAKMLSP--------------- 740
Fly 741 -----EHHSPVRSPAGG-----ALPPGVPPPPHHHPHHMARSPFFNPIKHE------MAALLPRP 789
Fly 790 HSNDNSWENFIEVSNTCETMKLKEL----MKNKKISDPNQ------------------------- 825
Fly 826 CVVCDRVLSCKSALQMHYRTHTGERPFKCRI--CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCP- 887
Fly 888 -VCHKKYSNALVLQQHIRLH 906 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
salm | NP_723670.2 | zf-C2H2 | 451..473 | CDD:278523 | |
C2H2 Zn finger | 453..473 | CDD:275368 | |||
zf-H2C2_2 | 465..490 | CDD:290200 | |||
C2H2 Zn finger | 481..501 | CDD:275368 | |||
C2H2 Zn finger | 826..846 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 838..863 | CDD:290200 | 12/26 (46%) | ||
zf-C2H2_2 | 854..922 | CDD:289522 | 19/57 (33%) | ||
C2H2 Zn finger | 854..874 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 886..906 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 1291..1311 | CDD:275368 | |||
zf-H2C2_2 | 1303..1328 | CDD:290200 | |||
C2H2 Zn finger | 1319..1339 | CDD:275368 | |||
pho | NP_524630.1 | Transpos_assoc | <342..382 | CDD:290671 | 7/39 (18%) |
C2H2 Zn finger | 359..381 | CDD:275368 | 1/21 (5%) | ||
COG5048 | <386..515 | CDD:227381 | 30/87 (34%) | ||
zf-C2H2 | 386..408 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 401..426 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 416..438 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 430..457 | CDD:290200 | 11/30 (37%) | ||
C2H2 Zn finger | 446..468 | CDD:275368 | 8/21 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1943 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |