DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi19

DIOPT Version :9

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster


Alignment Length:255 Identity:56/255 - (21%)
Similarity:89/255 - (34%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GTAWGLGPE--MALVRRVYDDCQDKNDFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSET 104
            |.|.|...|  ..|:....:.|....|.:.|:|::|:..:...:.:||.::.:   ||.::..| 
  Fly    18 GQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSFQVSN---LEVRSNGE- 78

  Fly   105 ESILGSLTDARQFGNLSPIDRALLSKAD-------KLMRTHTLKIDMDVG--------------- 147
                          ..:||:.|..|.||       ..:|.|.:.:|:.:.               
  Fly    79 --------------KTTPINEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQ 129

  Fly   148 -------GGEDSVGREHGHKKKKHKEGGHIK-------------YVVAALLTAMGI----AGPLG 188
                   .|:|  |.|....:.:.|:|...|             .:|..||.|:.:    .|.|.
  Fly   130 LSLNLQLNGDD--GDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILK 192

  Fly   189 LKALAAIA-GKALVISKVALTIAGIIALKKLFSHDHSEETSFQVHAGEHNRRNTYVIRPV 247
            :||..|:| |....|..|.|   .|..|.|..:|||........|.....|..:.|..||
  Fly   193 IKAFNALALGFFSFIVSVGL---AIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 15/101 (15%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 21/125 (17%)
DUF3671 <152..216 CDD:289205 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.