DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi15

DIOPT Version :9

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:69/154 - (44%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSKADKLMRTHTL 140
            ::.|:|...::|:.:..||.:::     :||       .|.||....:: :...:|::.:.||.|
  Fly    32 VNMLNRLDSEESVALFGGLRIDR-----SES-------GRSFGASKAVE-SFEDRAERYLETHEL 83

  Fly   141 KI-----DMDVGGGEDSVGREHGHKKKKHKEGGHIKYVVAALLTAMGIAGPLGLKALAA----IA 196
            .:     :.|.....:..||.....:.|     .:|.::..||.|:.:...:.:|.:..    |:
  Fly    84 NLSFSGDEQDENSENEYTGRAMDESRSK-----RMKKMLLPLLLALKLKKAVVVKIMFTIIKFIS 143

  Fly   197 GKALVISKVALTIAGIIALKKLFS 220
            .|||.||.:||.:||....|.|.:
  Fly   144 LKALAISFLALILAGATFFKDLLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 15/77 (19%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.