DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi14

DIOPT Version :9

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster


Alignment Length:226 Identity:59/226 - (26%)
Similarity:100/226 - (44%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CQDKNDFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSP--- 122
            |.:.:|...||..|.:.||:||...::|::..|:..::...|.......|:::...:..|..   
  Fly    44 CLESDDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNAD 108

  Fly   123 ------IDRALLSKADKLMRTHTLKIDMDVGGGEDSVGR--EHGHKKKKHKEGGHIKYVVAALLT 179
                  :|.|:.|.|| .:.||.|:..:.....: .|.|  :.|..|.| |..|.:...:.|.|.
  Fly   109 ERTGRLVDLAVSSAAD-FLSTHNLEFKLPAETTQ-QVARALDEGRGKIK-KMLGPVALAIGAKLF 170

  Fly   180 AMGIAGPLGLKALAAIAGKALVISKVALTIAGIIALKKLFSHDHSE--ETSFQVHAGEHNRRNTY 242
            |:   .||.|..||.:..||::::|:|..:|.::...:|.....::  ..||   ||.:| .|.:
  Fly   171 AV---IPLVLGFLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSF---AGAYN-SNAW 228

  Fly   243 VIRPVSKTSAAAGAGGVGVTAAGGSSSVDPY 273
                    ||.|.||.     :.|:||..||
  Fly   229 --------SAPASAGW-----SSGASSSYPY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 16/81 (20%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.