DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi10b

DIOPT Version :9

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:84/204 - (41%) Gaps:42/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HSAVESATTSSPGDWGTAWGLGPEMALVRRVYDDCQDKNDFIGCLKQKALHALSRAL-DQDSIKI 90
            |...|::..:|...|... .||       |:...|....|...||..::...|..|. |..:.:|
  Fly    21 HKGNETSANASTSPWSPR-SLG-------RIIAHCMGGADAWQCLGSESEQLLDGATRDNSTWQI 77

  Fly    91 VDGLALEKQ---NQSETE----SILGSLTDARQFGNLSPIDRALLSKADKLMRTHTLKIDMDVGG 148
            .|.|::|.:   ::.||.    .:.|.|.:..|       .|||..   :|.|..|:...:|..|
  Fly    78 TDYLSIEPKVGISKPETRRMDMGLPGKLLELVQ-------GRALRL---QLPRQLTISNAIDDFG 132

  Fly   149 GEDSVGREHGHKKK-KHKE----GGHIKYVVAALLTAMGIAGPLGLKALAAIAGKALVISKVALT 208
            .|  :|.:.|.||| |.|.    ||.|         .|.....:.|..:..|||.|.:::|:||.
  Fly   133 SE--LGLDQGRKKKDKDKNMAMMGGMI---------MMATLAQMFLGKVILIAGSAFIMAKIALV 186

  Fly   209 IAGIIALKK 217
            |:.:.:|||
  Fly   187 ISLLGSLKK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 21/80 (26%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.