DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi7

DIOPT Version :9

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:291 Identity:75/291 - (25%)
Similarity:126/291 - (43%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALVASVSTAVTPRRRRHSAVESATTSSPGDWGTAWGLGPEMALVRRVYDDCQDKNDFIGCL 71
            |.|:||.|::....|....|::                  :|.|..::..:|.||..| |.:.|:
  Fly    11 LCLVALSAALPAEETRGHARNA------------------IGGENDIMDSIYSDCLRK-DSVSCV 56

  Fly    72 KQKALHALSRALD-QDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSKADKLM 135
            |.|....:.:.|. :|...:.:|:.:.:...:..:....|::....|.:|:      |::....:
  Fly    57 KYKLFSFVDKVLGARDQFALTEGVTVVRSPDAPQQEAARSISGDESFESLA------LNRISSFL 115

  Fly   136 RTHTLKIDM---DVGGGEDSVGR--------------------EHGHKKKKHKEGGHIKYVV--- 174
            .:||:|:::   |:.....|.||                    ..|.|||..|..|.|..:|   
  Fly   116 NSHTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAPEESRGKKKKAAKILGPILALVALK 180

  Fly   175 -AALLTAMGIAGPLGLKALAAIAGKALVISKVALTIAGIIALKKLFSHDHSEETSFQVHAGEHNR 238
             ||||       ||.|.|:|.||||||:|.|:||.::.:|.||||.|.:  :..:::|.|..|:.
  Fly   181 AAALL-------PLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQE--KHVTYEVVAHPHHS 236

  Fly   239 RNTYVIRPVSKTSAAAGAGGVGVTAAGGSSS 269
                     |..|.:..:.|.|.:|..|:||
  Fly   237 ---------SSHSTSHDSYGSGYSADAGASS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 11/76 (14%)
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 50/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.