DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi24

DIOPT Version :10

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649620.2 Gene:Osi24 / 40755 FlyBaseID:FBgn0037409 Length:533 Species:Drosophila melanogaster


Alignment Length:149 Identity:25/149 - (16%)
Similarity:51/149 - (34%) Gaps:61/149 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 VVAALLTAMGIAGPLGLKALAAIAGKALV---ISKVALTIAGIIALKKLFSHDHS----EETSFQ 230
            |:.::|.||.:  |..:.:::.:.||.:.   ...|.|.|..|...::|...|:|    :::.|.
  Fly   236 VLKSVLFAMFL--PTIISSVSRLIGKGITSGSAGSVPLFIRPIEPPQELDFRDNSMNFDDDSKFS 298

  Fly   231 V--------------------------------------HAGEHNRRNTYV--IRPVSKT----- 250
            :                                      :.|:...::||:  ::.:...     
  Fly   299 LADEGKTPAGYEYNAEASQQQAQYAQVNGNSVNQATLSRYGGQQMMQDTYLSALQSIGAASFKNS 363

  Fly   251 -------SAAAGAGGVGVT 262
                   ||.||.|..|:|
  Fly   364 QSMSGSFSAGAGGGAPGMT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 60..217 CDD:462310 11/46 (24%)
Osi24NP_649620.2 None

Return to query results.
Submit another query.