DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and lolal

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:113 Identity:69/113 - (61%)
Similarity:92/113 - (81%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHP 140
            |.:.|||||||:::::||||||||:.|.||||||:.::..|||:|||||||||:.||:.||.:||
  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP 70

  Fly   141 IVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD 188
            |:||:||....::.:|.|||.||||||.||||.|||||..|:::|||:
  Fly    71 IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 60/96 (63%)
BTB 104..189 CDD:197585 52/85 (61%)
zf-Di19 545..597 CDD:283297
C2H2 Zn finger 546..567 CDD:275371
C2H2 Zn finger 575..596 CDD:275371
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 50/82 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451873
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.