DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and CG15812

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster


Alignment Length:545 Identity:114/545 - (20%)
Similarity:189/545 - (34%) Gaps:145/545 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LKWNDFQSSILSSFRHLRDEEDFVDVTLAC-DERSFTAHKVVLSACSPYFRRLLKANP-CEHPIV 142
            |||....|:|:...|.||::....:|.||. |.....||..|||.||...|.||...| .:...:
  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68

  Fly   143 ILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALSAALSH-- 205
            :|.|:|.|.:|.:|||:|.||.::....||:||:..:||.|:                :|:|.  
  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIK----------------SAISFEC 117

  Fly   206 NSSNNNNNNSSSNNSLSNNNNNNNNNAESSNHNKISSYLSPN-QTSAACNNSSNSNSNNHSSSHN 269
            |.|.:..:....|:||:..:..:....:.:....:.....|: ..|......:.|   .|..||:
  Fly   118 NPSASPPSVDVENHSLAVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGS---QHQPSHS 179

  Fly   270 NSSSNNISGSLNSSLNSPFSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAA 334
            :.|...|.             ...||.:|.|......:::.:...........|...:.||.|..
  Fly   180 SRSLEYID-------------VYEPPKITYSIEHMDGSSSGNQFILTENTGTFTITQSASSLSKI 231

  Fly   335 SGQTSGTPAIQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLF 399
            ....:||                          |....|:|:.:               ..||| 
  Fly   232 EADETGT--------------------------SGAEVDLGDDD---------------VDADL- 254

  Fly   400 RAQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANPKH 464
             |:.....|..::|.||  |...||....:|.:...|.    ::.:.|:.:.:::...:....|.
  Fly   255 -AEDSEEHESQMIDEEF--AQADPLMELEAGTEMDDDD----DVHDQLVDEEIDDKPRKLGGGKT 312

  Fly   465 ELGQ--SAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFP----------NAFLGLQG---- 513
            .:.:  ||......||.:|:                 |...|.          |..|.|..    
  Fly   313 RIRRPISAKAVKRLSDCKPT-----------------RIQQFAALKREVKDDINDALDLAADAVI 360

  Fly   514 IPGLLPGPSGINSDFVSRRSLEMRVRATDP------RPCPKCGKIY---RSAHTLRTHLEDKHTV 569
            |.||....:....| :|:..|..||| |:|      |..|...:.|   ::.|:|::        
  Fly   361 IEGLSLQKAADRFD-ISKTVLWRRVR-TNPAYMRNNRERPSLQEAYERLKNGHSLKS-------- 415

  Fly   570 CPGYRCVLCGTVAKSRNSLHSHMSR 594
                   :...:....::||.|..|
  Fly   416 -------ISSELQIPMSTLHRHKVR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 36/97 (37%)
BTB 104..189 CDD:197585 33/86 (38%)
zf-Di19 545..597 CDD:283297 8/53 (15%)
C2H2 Zn finger 546..567 CDD:275371 4/23 (17%)
C2H2 Zn finger 575..596 CDD:275371 4/20 (20%)
CG15812NP_523897.2 BTB 20..113 CDD:279045 35/108 (32%)
BTB 35..118 CDD:197585 32/98 (33%)
HTH_psq 348..392 CDD:283007 14/45 (31%)
HTH_psq 458..501 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.