DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and Zbtb43

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001012094.1 Gene:Zbtb43 / 311872 RGDID:1310287 Length:503 Species:Rattus norvegicus


Alignment Length:577 Identity:116/577 - (20%)
Similarity:195/577 - (33%) Gaps:152/577 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TMAATGSALSPATPPPSLNLSHQQQQHQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDER 112
            |:...|..:.|.|               ..:.:::.||.|:||......|.:....||::.....
  Rat    29 TLNKIGDEMEPGT---------------NSFQVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGH 78

  Fly   113 SFTAHKVVLSACSPYFRRLLKANPCEHPI------VILRDVRCDDV-ENLLSFMYNGEVNVSHEQ 170
            .|.|||.||:|.||||        |:..:      ::|.||....| ||:|.|.|.|.:.:...:
  Rat    79 IFQAHKAVLAASSPYF--------CDQVLLKNSRRIVLPDVMNPRVFENILLFSYTGRLVMPAPE 135

  Fly   171 LPDFLKTAHLLQIRGLAD----VNGGYPYSKALSAALSHNS-----SNNNNNNSSSNNSLSNNNN 226
            :..:|..|..||:..:.|    |..|.|  ..|...|:|.|     |::|.|..:.:..|.:..:
  Rat   136 IVSYLTAASFLQMWHVVDKCTEVLEGNP--TVLCQKLNHGSDHQSPSSSNYNGLAESFELGSGGH 198

  Fly   227 ---------NNNNNAESSNHNKISSYLSPNQTSAACNNSSNSNSNNHSSSHNNSSSNNISGSLNS 282
                     .:..|.|.|..:::||.::.::..     .|||::.:...|...:|.:...|: |.
  Rat   199 TDFPKAQELRDGENEEESTKDELSSQVTEHEYL-----PSNSSTEHDRLSTEMASQDGEEGT-ND 257

  Fly   283 SLNSPFSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPAIQEL 347
            |....::.|                                              ....|:|...
  Rat   258 STEFHYTRP----------------------------------------------LYSKPSIMPH 276

  Fly   348 KASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLL 412
            :......|.|...|          ||..::..:...|...      :|.:..:..|...|..  .
  Rat   277 RRWIHVKPERLEQP----------WDGMDVHAAYDEHQVS------ESVNTMQTDHSAQPSG--A 323

  Fly   413 DREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQ-----ANPKHELGQSAGE 472
            :.||.:..:..........:.|     |.:.:....|.::|..:|::     ...|.|...:||.
  Rat   324 EEEFQIVEKKVEVEFDEHAEGS-----NYDEQVDFYGSSMEEFSGEKLGGGLIGHKQETALAAGY 383

  Fly   473 DSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGINSDFVSRRSLEMR 537
            ..|..              .:.||..:.||      ||......|.|...|.:....|:|...|.
  Rat   384 SENIE--------------MVMGIKEEASH------LGFSATDKLYPCQCGKSFTHKSQRDRHMS 428

  Fly   538 VR-ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSRNSLHSHMS 593
            :. ...|..|..|||.::..|.|..|:: .||....|.|.:|......|:|.|.|::
  Rat   429 MHLGLRPYGCSVCGKKFKMKHHLVGHMK-IHTGIKPYECNICAKRFMWRDSFHRHVT 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 30/106 (28%)
BTB 104..189 CDD:197585 29/95 (31%)
zf-Di19 545..597 CDD:283297 16/49 (33%)
C2H2 Zn finger 546..567 CDD:275371 7/20 (35%)
C2H2 Zn finger 575..596 CDD:275371 6/19 (32%)
Zbtb43NP_001012094.1 BTB_POZ_ZBTB43 44..164 CDD:349536 38/129 (29%)
C2H2 Zn finger 412..430 CDD:275368 4/17 (24%)
C2H2 Zn finger 438..458 CDD:275368 7/20 (35%)
zf-H2C2_2 450..473 CDD:404364 7/23 (30%)
C2H2 Zn finger 466..483 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.