DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and Zbtb6

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_666365.1 Gene:Zbtb6 / 241322 MGIID:2442998 Length:423 Species:Mus musculus


Alignment Length:540 Identity:102/540 - (18%)
Similarity:173/540 - (32%) Gaps:186/540 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEH-PIVILRDVRCDDV 152
            :|.....||.:..|.||::..::..|..|||:|:|||.:.|........:| .|.||:.....  
Mouse    19 VLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHVRITILQSAEVG-- 81

  Fly   153 ENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSNNNNNNS-- 215
            ..||...|.|.:.|..::|..:|..|..||:..:.:     ..::|||..|..:.|..||.::  
Mouse    82 WKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVE-----KCTEALSKYLEIDLSMKNNQHTDL 141

  Fly   216 --SSNNSLSNNNNNNNNNAESSNHNKISSYLSPNQTSAACNNSSNSNSNNHSSSHNNSSSNNISG 278
              ||:..:.|...|::.:.|.                                         |..
Mouse   142 CQSSDTDVKNEEENSDKDCEI-----------------------------------------IEI 165

  Fly   279 SLNSSLNSPFSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPA 343
            |.:|.:|..|.       |....:.|..:||.:||                              
Mouse   166 SEDSPVNLDFH-------VKEEESNALQSAAETLT------------------------------ 193

  Fly   344 IQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPE 408
                     :..:|..:|..|....          |.:::.:.....:.|.:.|:...|.     
Mouse   194 ---------SERMRMQSPELSAVDG----------GFKENEICILHVESISTDDVENGQF----- 234

  Fly   409 RLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANPKHELGQSAGED 473
                        ..|.|.:::|....       |.:.||:...:||          .:.:..|  
Mouse   235 ------------SQPCTSSKAGIYFP-------ETQHSLINSTVEN----------RVTEVPG-- 268

  Fly   474 SNSSDTEPSDRGDGQHDGTLDGIDN-----QRSHSFPNA-------------------FLGLQGI 514
             |::....|:..||.| ||::.|.|     ...|..|..                   ||.||  
Mouse   269 -NTNQGLFSENSDGSH-GTVNEIQNLDENFSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQ-- 329

  Fly   515 PGLLPGPSGINSDFVSRRSLEMRVR---ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCV 576
                     ....|..:::|...:|   ...|..|..|.|.:.:..||:.|| :.|:....|:|.
Mouse   330 ---------CGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHL-NIHSGDRPYKCH 384

  Fly   577 LCGTVAKSRNSLHSHMSRQH 596
            .|....|.:::|..|::..|
Mouse   385 CCDMDFKHKSALKKHLTSVH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 28/96 (29%)
BTB 104..189 CDD:197585 25/85 (29%)
zf-Di19 545..597 CDD:283297 15/52 (29%)
C2H2 Zn finger 546..567 CDD:275371 7/20 (35%)
C2H2 Zn finger 575..596 CDD:275371 5/20 (25%)
Zbtb6NP_666365.1 BTB 23..123 CDD:279045 28/106 (26%)
BTB 34..127 CDD:197585 28/99 (28%)
C2H2 Zn finger 302..322 CDD:275368 1/19 (5%)
zf-C2H2 325..347 CDD:278523 7/32 (22%)
C2H2 Zn finger 327..347 CDD:275368 5/30 (17%)
zf-H2C2_2 339..363 CDD:290200 6/23 (26%)
C2H2 Zn finger 355..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..400 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.