DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and Zbtb37

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001343418.1 Gene:Zbtb37 / 240869 MGIID:2444467 Length:504 Species:Mus musculus


Alignment Length:608 Identity:134/608 - (22%)
Similarity:209/608 - (34%) Gaps:162/608 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVR 148
            ||.:|:||....||.:....|:.:....::|.||||||:|.|||||..:..|  |...|.:..::
Mouse    15 DFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN--EMSTVSISVIK 77

  Fly   149 CDDV-ENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD----VNGGYPYS---KALSAALSH 205
            ...| |.||||.|.|.:.:....:..:|..|..||::.:.|    :..|..:.   ..:.|.||.
Mouse    78 NPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQILEGIHFKINVAEVEAELSQ 142

  Fly   206 NSSNNNNNNSSSNNSLSNNNNNNNNNAESSNHNKISSYLSPNQTSAACNNSSNSNSNNHSSSHNN 270
            ..:.:......|:.:..|.|.:                |||                     .:|
Mouse   143 TRTKHQERPPESHRATPNLNRS----------------LSP---------------------RHN 170

  Fly   271 SSSNNISGSLNSSLN----SPFSAPQIPPPVTASSAAAAAAAAASLTAA----VAAAAAATAASA 327
            :|..|..|.:::.|:    ||...|..|..:..||.|........:..|    |....|...|.:
Mouse   171 ASKGNWRGQVSAVLDIRELSPPEEPTSPQIIEQSSDAEGREPILRINRAGQWYVETGLADQGARS 235

  Fly   328 GSSSSAASGQTSGTPAIQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKR 392
            |............|..::|.         ..|...||          || :||....:|      
Mouse   236 GDEVRVLGAVHIKTENLEEW---------LGPENQPS----------GE-DGSSAEEVT------ 274

  Fly   393 IKSADLFRAQHGISPERLLLDREFPVAGQHPLTRNRSG----RDTSKDRER--------NLELRE 445
              :..:....||             ..||...|...||    |.||.:.:|        ::..|.
Mouse   275 --AMVIDTTGHG-------------SIGQESYTLGSSGAKVARPTSSEVDRFSPSGSVVSMTERH 324

  Fly   446 SLLGQALENSNGQQANPKHELGQSAGEDSNSS---------DTEPSDRGDGQHDGTLDGIDNQRS 501
                :|...|.|:...|| :|.....|.:...         :.|.|:|. .:::..|..|...:|
Mouse   325 ----RARSESPGRMDEPK-QLSSQVEESAMMGVSAYVEYLREQEVSERW-FRYNPRLTCIYCAKS 383

  Fly   502 HSFPNAFLGLQGIPGLLPGPSGINSDFVSRRSLEMRVR---ATDPRPCPKCGKIYRSAHTLRTHL 563
                                      |..:.||:..:|   ...|..|..|||.|.....|..|:
Mouse   384 --------------------------FNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHI 422

  Fly   564 EDKHTVCPGYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPVLPMPSAFDPELASRLLAKAGVK 628
            . |||....:.|.:||.....:..|:.|..:.|.|.    :| |..|.:..||  :.:.::...:
Mouse   423 R-KHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGC----IP-LEGPHSISPE--TTVTSRQAEE 479

  Fly   629 ISPA--ELRARASPTGGSGSSGG 649
            .||:  |:.|......||.|:.|
Mouse   480 GSPSHEEIVAPGESAQGSVSTTG 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 32/100 (32%)
BTB 104..189 CDD:197585 30/89 (34%)
zf-Di19 545..597 CDD:283297 15/51 (29%)
C2H2 Zn finger 546..567 CDD:275371 7/20 (35%)
C2H2 Zn finger 575..596 CDD:275371 5/20 (25%)
Zbtb37NP_001343418.1 BTB_POZ_ZBTB37 9..131 CDD:349531 38/117 (32%)
C2H2 Zn finger 377..397 CDD:275368 6/45 (13%)
zf-H2C2_2 389..414 CDD:404364 9/24 (38%)
zf-C2H2 403..425 CDD:395048 7/22 (32%)
C2H2 Zn finger 405..425 CDD:275368 7/20 (35%)
zf-H2C2_2 418..440 CDD:404364 8/22 (36%)
C2H2 Zn finger 433..451 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11797
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.