DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and ZBTB9

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_689948.1 Gene:ZBTB9 / 221504 HGNCID:28323 Length:473 Species:Homo sapiens


Alignment Length:589 Identity:121/589 - (20%)
Similarity:182/589 - (30%) Gaps:198/589 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TGSALSPATPPPSLNLSHQ--QQQHQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF 114
            |.:.|.|....|:.|.:.:  |.:..||        .||:|.|....|.|..|.||:|....|..
Human     3 TPTPLPPVPASPTCNPAPRTIQIEFPQH--------SSSLLESLNRHRLEGKFCDVSLLVQGREL 59

  Fly   115 TAHKVVLSACSPYFRRLLKANPCEHPIVILRD---------VRCDDVENLLSFMYNGEVNVSHEQ 170
            .|||.||:|.||||          |..::|.|         :..|..|.||..:|:|.:.:..:.
Human    60 RAHKAVLAAASPYF----------HDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDA 114

  Fly   171 LPDFLKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSNNNNNNSSSNNSLSNNNNNNNNNAESS 235
            ||..|..|..||:..:.|                 ..|.......:|...:|....|       |
Human   115 LPAHLLVASGLQMWQVVD-----------------QCSEILRELETSGGGISARGGN-------S 155

  Fly   236 NHNKISSYLSPNQTSAACNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSPFSAPQIPPPVTAS 300
            .|..:|   :.:.|...|..|                             |||..|         
Human   156 YHALLS---TTSSTGGWCIRS-----------------------------SPFQTP--------- 179

  Fly   301 SAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPAIQELKASSAASPVRNPNPNPSK 365
                             ..::|:..|..|:.|...|:.|....:.:::.              .:
Human   180 -----------------VQSSASTESPASTESPVGGEGSELGEVLQIQV--------------EE 213

  Fly   366 ASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPLTRNRSG 430
            .......|..|.:||.....||.||   :.:.:|...|                |.|||....:.
Human   214 EEEEEEDDDDEDQGSATLSQTPQPQ---RVSGVFPRPH----------------GPHPLPMTATP 259

  Fly   431 RDTSKDRERNLEL-RESLLGQALENSNGQQANPKHELGQSAGEDSNS-SDTEPSDRGDGQHDGTL 493
            |...:.....||| ....|...:.....:...||.|:..|..:...: .:|:....||.:.:|.|
Human   260 RKLPEGESAPLELPAPPALPPKIFYIKQEPFEPKEEISGSGTQPGGAKEETKVFSGGDTEGNGEL 324

  Fly   494 DGIDNQRSHSFPNAFLGLQGIPGLLP-----GPSGINSDFVSRRSLE---------------MRV 538
                         .|| |...||  |     |||....|......|.               :::
Human   325 -------------GFL-LPSGPG--PTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKL 373

  Fly   539 RATDPRPCPK----CGKIY-----RSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSRNSLHSHMSR 594
            ..|.|....:    |||.:     |..|.:.|     .::.| :.|.:|....|.::.|..|| :
Human   374 GGTPPADGKRFGCLCGKRFAVKPKRDRHIMLT-----FSLRP-FGCGICNKRFKLKHHLTEHM-K 431

  Fly   595 QHRG 598
            .|.|
Human   432 THAG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 32/104 (31%)
BTB 104..189 CDD:197585 29/93 (31%)
zf-Di19 545..597 CDD:283297 13/60 (22%)
C2H2 Zn finger 546..567 CDD:275371 6/29 (21%)
C2H2 Zn finger 575..596 CDD:275371 6/20 (30%)
ZBTB9NP_689948.1 BTB 38..140 CDD:306997 34/128 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..279 25/160 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..376 19/98 (19%)
C2H2 Zn finger 388..405 CDD:275368 5/16 (31%)
C2H2 Zn finger 413..433 CDD:275368 6/20 (30%)
zf-C2H2 413..433 CDD:306579 6/20 (30%)
C2H2 Zn finger 440..457 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5010
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.