DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and ZBTB6

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens


Alignment Length:560 Identity:105/560 - (18%)
Similarity:165/560 - (29%) Gaps:225/560 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEH-PIVILRDVRCDDV 152
            :|.....||.:..|.||::..::..|..|||:|:|||.:.|........:| .|.||:.....  
Human    19 VLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHVRITILQSAEVG-- 81

  Fly   153 ENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSNNNNNN--- 214
            ..||...|.|.:.|..::|..:|..|..||:..:.:     ..::|||..|..:.|..|||.   
Human    82 RKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVE-----KCTEALSKYLEIDLSMKNNNQHTD 141

  Fly   215 --SSSNNSLSNNNNNNNNNAESSNHNKISSYLSPNQTSAACNNSSNSNSNNHSSSHNNSSSNNIS 277
              .||:..:.|.:.|::.:.|.                                         |.
Human   142 LCQSSDPDVKNEDENSDKDCEI-----------------------------------------IE 165

  Fly   278 GSLNSSLNSPFSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTP 342
            .|.:|.:|..|.       |....:.|..:...|||:                            
Human   166 ISEDSPVNIDFH-------VKEEESNALQSTVESLTS---------------------------- 195

  Fly   343 AIQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGISP 407
                                                          .:|.:|           ||
Human   196 ----------------------------------------------ERKEMK-----------SP 203

  Fly   408 ERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANP---------- 462
            |...:|..|                  ||.|..:...||:....:|  |||.:.|          
Human   204 ELSTVDIGF------------------KDNEICILHVESISTAGVE--NGQFSQPCTSSKASMYF 248

  Fly   463 ---KHELGQSAGEDSNSSDTEPSDRG------DGQHDGTLDGIDNQRS-----HSFPNA------ 507
               :|.|..|..|...:......|:|      :|.: ||:..|.|...     |..|..      
Human   249 SETQHSLINSTVESRVAEVPGNQDQGLFCENTEGSY-GTVSEIQNLEEGYSLRHQCPRCPRGFLH 312

  Fly   508 -------------FLGLQGIPGLLPGPSGINSDFVSRRSLEMRVR---ATDPRPCPKCGKIYRSA 556
                         ||.||           ....|..:::|...:|   ...|..|..|.|.:.:.
Human   313 VENYLRHLKMHKLFLCLQ-----------CGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAK 366

  Fly   557 HTLRTHLEDKHTVCPGYRCVLCGTVAKSRNSLHSHMSRQH 596
            .||:.|| :.|:....|:|..|....|.:::|..|::..|
Human   367 STLQDHL-NIHSGDRPYKCHCCDMDFKHKSALKKHLTSVH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 28/96 (29%)
BTB 104..189 CDD:197585 25/85 (29%)
zf-Di19 545..597 CDD:283297 15/52 (29%)
C2H2 Zn finger 546..567 CDD:275371 7/20 (35%)
C2H2 Zn finger 575..596 CDD:275371 5/20 (25%)
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 29/110 (26%)
C2H2 Zn finger 303..323 CDD:275368 1/19 (5%)
zf-C2H2 326..348 CDD:395048 7/32 (22%)
C2H2 Zn finger 328..348 CDD:275368 5/30 (17%)
zf-C2H2_8 331..401 CDD:406359 17/70 (24%)
zf-H2C2_2 340..364 CDD:404364 6/23 (26%)
C2H2 Zn finger 356..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 384..401 CDD:275368 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5010
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.