DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ab and Btbd18

DIOPT Version :9

Sequence 1:NP_476562.1 Gene:ab / 34560 FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001138572.1 Gene:Btbd18 / 100270744 MGIID:3650217 Length:723 Species:Mus musculus


Alignment Length:690 Identity:145/690 - (21%)
Similarity:227/690 - (32%) Gaps:224/690 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPATP------PPSLNLSHQQQQHQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFT 115
            |||:.      |..|.::..|..|||         ||.:            |.|..|..:..:..
Mouse     3 SPASSKILYRNPRFLRVAFLQLHHQQ---------QSGV------------FCDALLQAEGEAVP 46

  Fly   116 AHKVVLSACSPYF-RRLLKANPCEHPIVILR--DVRCDDVENLLSFMYNGEVNVSHEQLPDFLKT 177
            ||..:||||||:| .||.:..|.:...|:|.  .::...:..|:.|:|..|:.||.|:..|.|..
Mouse    47 AHCCILSACSPFFTERLERERPVQGRKVVLEMGGLKIQTLRKLVDFLYTSEMEVSQEEAQDVLSA 111

  Fly   178 AHLLQIRGL--ADVNGGY-----------------PYSKALSAAL-------------------- 203
            |..|::..|  ..:.||.                 |.:..:||.:                    
Mouse   112 ARQLRVSELETLQLEGGKLVKAPQGRRLNRECLQPPAAAPISARVVGPKSRPQTPLPVTQTPSPL 176

  Fly   204 -------------SHNSSNNNNNNSSSNNSLSNNN----NNNNNNAESSNHNKISSYLSPNQTSA 251
                         :|..:|..|.:|.|:..|....    ...:.::.||...      .|.:|.:
Mouse   177 GAVRLKSLGEEEGAHKKTNLPNADSLSDTQLKKKARVCLTQESRSSPSSQRE------GPKETKS 235

  Fly   252 ACNNSSNSNSNNHSS------------SHNNSSSNNISGSLNSSLNSPFSAPQIP-----PPVTA 299
              |....:..:.:.|            |.:..|.:..:.:.:|.|:.|.|.|..|     ...|.
Mouse   236 --NPGPTALPSLYPSVDEQLLPRKIRLSRSKPSPHVYTSTPSSILSGPSSMPTAPGRRLWRQRTV 298

  Fly   300 SSAAAAA-----AAAASLTAAVAAAAAATAAS---------AGSSSSAASGQ---------TSGT 341
            |..|...     .....|.:....:.....|.         |.:|||...||         .:||
Mouse   299 SKEAQGVDKQKPGEVRPLQSTPDPSDVGKPAENKKQSPELRAPTSSSVEEGQVGRVKLRKIVNGT 363

  Fly   342 --PAIQELKASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLT-------------PPPQK 391
              ..:||       .|:||...:|.....|   |:.|..|:..|.:.             .|...
Mouse   364 CWEVVQE-------PPLRNTQDSPQILEPS---DVEEPSGTLLSSVNEQEIPARIQLCQDSPESP 418

  Fly   392 RIKSADLFRAQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRE------SLLGQ 450
            |::.. |..|.|  ||:..::..||   |..|:.       |.|:.:.|::.||      :||||
Mouse   419 RLQDI-LLSASH--SPDHPMVKSEF---GSSPML-------TGKESDLNIDCREPYTFDTTLLGQ 470

  Fly   451 ALENSNGQ--QANPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLD--GIDNQRSHSFPNAFLGL 511
            ..|....:  .|....||.:........||.||.       .|:|:  |.:..|:.|:..:..|.
Mouse   471 PCEAEQYRITSAAATSELEEIFDFMLCGSDVEPP-------VGSLESPGAEGCRTPSYHLSETGK 528

  Fly   512 QGIPG---LLPGP-------SGINSDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDK 566
            ..|.|   .||..       :|:..:.||.....:.         |....:.||.:|     |..
Mouse   529 NWIEGEEWCLPDMELWPRDLTGLEKEPVSENKEPVE---------PFSPLVMRSENT-----ESF 579

  Fly   567 HTVCPGYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPV 606
            ..:.|   .|:...|::...||        ||..|.||.:
Mouse   580 EPLSP---LVMPSEVSREELSL--------RGSWTPDLEI 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 29/100 (29%)
BTB 104..189 CDD:197585 28/89 (31%)
zf-Di19 545..597 CDD:283297 10/51 (20%)
C2H2 Zn finger 546..567 CDD:275371 5/20 (25%)
C2H2 Zn finger 575..596 CDD:275371 4/20 (20%)
Btbd18NP_001138572.1 BTB_POZ_BTBD18 20..138 CDD:349602 37/138 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..176 2/25 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..350 29/169 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..394 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..637 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.