DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Adcy7

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:141/266 - (53%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 MLSIMEKYAYNLEGLVQERTNLLYEEKKKTD----MLLYQMLPRPVAELL---KRGDPVEAECFD 898
            :||....|...|:.|.:::....:||.:..:    :||..:||..||...   |..:....:.:|
  Rat   832 LLSRQIDYYCRLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYD 896

  Fly   899 CVTILFSDI----VGFTELCTTSTPFEVVEMLNDWYTCCDSIISNYD----------VYKVETIG 949
            ||.::|:.:    |.:||........|.:.:||:       ||:::|          |.|::|||
  Rat   897 CVCVMFASVPDFKVFYTECDVNKEGLECLRLLNE-------IIADFDELLLKPKFSGVEKIKTIG 954

  Fly   950 DAYMVVSGLPLQNGSR---------HAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPC 1005
            ..||..:||.:.:|..         |.|.:...::.|:..:..:. ||. ..:.:||:|::.||.
  Rat   955 STYMAAAGLSVPSGHENQDLERKHVHIGVLVEFSMALMSKLDGIN-RHS-FNSFRLRVGINHGPV 1017

  Fly  1006 AAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGD 1070
            .|||:|.:.|:|.::|:|||.||||||||:..:|.::|.|..:||.:| |.|..|||.::||||:
  Rat  1018 IAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLG-YSCECRGLINVKGKGE 1081

  Fly  1071 MRTYWL 1076
            :|||::
  Rat  1082 LRTYFV 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 11/42 (26%)
CYCc 865..1057 CDD:214485 67/221 (30%)
Guanylate_cyc 892..1076 CDD:278633 69/206 (33%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677 69/205 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.