DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and CRLK2

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001078591.1 Gene:CRLK2 / 831429 AraportID:AT5G15730 Length:436 Species:Arabidopsis thaliana


Alignment Length:335 Identity:75/335 - (22%)
Similarity:141/335 - (42%) Gaps:50/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 WKVDMKDVTVINLG--EYNNPTNKNIFQICRQSILVVGEPNKRSFTNIALFRGNIVAMKKIHKKS 593
            |....||:||...|  .||   .|:|.:..:....|:|:.:........:..|.:.|.|.....|
plant    87 WNNHTKDLTVSASGIPRYN---YKDIQKATQNFTTVLGQGSFGPVYKAVMPNGELAAAKVHGSNS 148

  Fly   594 VDITRSIRKELKLMREVRHENIINFIGASTDHGSVIIFTTYCARGSLEDVLANED----LHLDHM 654
            ....|..:.|:.|:..:.|.|::|..|...|....::...:.:.||||::|...:    |:.:..
plant   149 SQGDREFQTEVSLLGRLHHRNLVNLTGYCVDKSHRMLIYEFMSNGSLENLLYGGEGMQVLNWEER 213

  Fly   655 FISSLVSDILKGMIYLHDSEI--ISHGNLRSSNCLIDSRWVCQISDFGLHELKAGQEEPNKSELE 717
            .  .:..||..|:.|||:..:  :.|.:|:|:|.|:|.....:::||||           ..|:.
plant   214 L--QIALDISHGIEYLHEGAVPPVIHRDLKSANILLDHSMRAKVADFGL-----------SKEMV 265

  Fly   718 LKRALC--------MAPELLRDAYRPGRGSQKGDVYSFGILLYEMIGRKGPWGDTA-YSKEEIIQ 773
            |.|...        |.|..:    ...:.:.|.|:||||:::.|:|        || :.::.:::
plant   266 LDRMTSGLKGTHGYMDPTYI----STNKYTMKSDIYSFGVIILELI--------TAIHPQQNLME 318

  Fly   774 FVKCPEMLQHGV----FRPALTHTHLDIPDYIRKCLCQCWDEDPEVRPDI-RLVRMHLKELQAGL 833
            ::....|...|:    .:..:.:..::....:.|...:|..:.|..||.| .:.:..||..|:..
plant   319 YINLASMSPDGIDEILDQKLVGNASIEEVRLLAKIANRCVHKTPRKRPSIGEVTQFILKIKQSRS 383

  Fly   834 KPNIFDNMLS 843
            :....|.|.|
plant   384 RGRRQDTMSS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 68/313 (22%)
PK_GC-A_B 550..832 CDD:270944 64/301 (21%)
HNOBA <847..886 CDD:285003
CYCc 865..1057 CDD:214485
Guanylate_cyc 892..1076 CDD:278633
CRLK2NP_001078591.1 S_TKc 119..373 CDD:214567 59/278 (21%)
STKc_IRAK 120..378 CDD:270968 59/282 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.