DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and adcy6a

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:XP_017209219.1 Gene:adcy6a / 570652 ZFINID:ZDB-GENE-060221-1 Length:1203 Species:Danio rerio


Alignment Length:285 Identity:90/285 - (31%)
Similarity:144/285 - (50%) Gaps:38/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 RLVRMHLKELQAGLKPNIFDNMLSIMEKYAYNLEGLVQERTNLLY-----EEKKKTD-------M 872
            |:.::.||.    :.|.|....:..:..:|..:|...  |.:.|:     |||::.:       .
Zfish   922 RVTKVSLKV----MTPVILTVFVLALYLHAQQVESTA--RLDFLWKLQATEEKEEMEELQAYNRR 980

  Fly   873 LLYQMLPRPVAELL----KRGDPVEAECFDCVTILFSDIVGFT----ELCTTSTPFEVVEMLNDW 929
            ||:.:||:.||...    :|.|.:..:..:||.::|:.|..|:    ||...:...|.:.:||:.
Zfish   981 LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEI 1045

  Fly   930 YTCCDSIISN---YDVYKVETIGDAYMVVSGLP----LQNGSRHAGEIASLALHLLETVGNLK-I 986
            ....|.|||.   ..:.|::|||..||..|||.    .:.|..|...:|..|:||.|   .:| |
Zfish  1046 IADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLRE---QMKYI 1107

  Fly   987 RHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQV 1051
            ........|::||::.||..|||:|.:.|:|.::|:|||.||||:|||...||.::...:|:|..
Zfish  1108 NEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLHQVLHS 1172

  Fly  1052 IGSYVCIERGLTSIKGKGDMRTYWL 1076
            .| |....||:..:||||:|.||:|
Zfish  1173 KG-YQLECRGVIKVKGKGEMTTYFL 1196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 1/5 (20%)
PK_GC-A_B 550..832 CDD:270944 3/11 (27%)
HNOBA <847..886 CDD:285003 13/50 (26%)
CYCc 865..1057 CDD:214485 71/214 (33%)
Guanylate_cyc 892..1076 CDD:278633 69/195 (35%)
adcy6aXP_017209219.1 AC_N <97..395 CDD:318454
Guanylate_cyc 397..570 CDD:306677
DUF1053 609..696 CDD:310728
Guanylate_cyc 1004..1197 CDD:306677 70/197 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.