DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and ACXB

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:407 Identity:102/407 - (25%)
Similarity:162/407 - (39%) Gaps:118/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   842 LSIMEKYAYNLEGL-------------VQERTNLLYEE------KKKTDMLLYQMLP----RPVA 883
            :.|.....:||.|:             ..:|...|.||      :::..|||..:||    :|:.
  Fly   206 VDIFHYLGFNLMGIFFRIMNDTMVRSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQ 270

  Fly   884 ELLKR--------GDPV-----EAECFDC------VTILFSDIVGFTELCTTSTPFEVVEMLNDW 929
            :.:|.        .|.:     ..|.|..      |:||::|:|.:|.|.||.|..::|::|:|.
  Fly   271 QSIKERIMLSETDSDRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDL 335

  Fly   930 YTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGSRHAGEIASLALHLLETVGNLKIRHKPTETV 994
            |...|...|.:.|.:::.:||.|..|:||. :....||....||.:.::..:..:: .|:..: :
  Fly   336 YGRFDMAASTFKVQRIKFLGDCYYCVAGLG-EADPDHARMAVSLGISMIANIQEVR-AHRALD-I 397

  Fly   995 QLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVI------G 1053
            .:|||||||...|||:||...:|.::|..|:.|:|:|:||....:|:|..|...|.|.      |
  Fly   398 DMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPG 462

  Fly  1054 SYVCIERGLTSIKGKGDMRTYWLT---------------------------KRQQPELTPDLIST 1091
            :.|...   ..|..|..|.||.||                           .|:.|.|.|.|:| 
  Fly   463 TEVAQS---DPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMS- 523

  Fly  1092 VDTLDTYCSGPRESMEVSVHQYCSPASNNYRLGSCNCDTKCLYSRRSDDNVTNSHGTSEFPKVSE 1156
             |.|       ||..:            ...:|..|..:.|.....:|:.|  :||...|     
  Fly   524 -DEL-------REEFK------------KMPVGGFNIRSPCCRDNSNDEKV--NHGLGMF----- 561

  Fly  1157 PAQVNCNQLCVCRLNSS 1173
                     ||...:||
  Fly   562 ---------CVAFKDSS 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 13/61 (21%)
CYCc 865..1057 CDD:214485 66/226 (29%)
Guanylate_cyc 892..1076 CDD:278633 62/200 (31%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831 15/69 (22%)
CYCc 249..459 CDD:214485 63/212 (30%)
Nucleotidyl_cyc_III 298..484 CDD:299850 61/191 (32%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.