DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and NPR3

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:478 Identity:109/478 - (22%)
Similarity:204/478 - (42%) Gaps:68/478 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AIEDVNKNPN----LLPGKK--LAFKPVDIGHKMSAYRVKPLRAMTQMREAGVTAFIGP--DESC 121
            |:..|..|..    |.||.:  :|::..|.|::.....|..:.|   .|.|.....:||  :.:.
Human    79 ALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAA---ARGAKPDLILGPVCEYAA 140

  Fly   122 TTEALLASAWNTPMLSFKCSDPIVSNKSTFHTFARTLAPA-SKVSKSVISLLNAFHWNKFSIVVS 185
            ...|.|||.|:.||||.........:|.:.::....:||| :|:.:.:::|....||::.::|.|
Human   141 APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYS 205

  Fly   186 SKPIWGS--DVARAIQELAEARNFTISHFKYISDYIPTTKTLSQIDKIIEETYATTRIYVFIGEH 248
            ...:..:  .....:.|:.:......|.:.:     ..||.| .::.|:....|:.|:.:.    
Human   206 DDKLERNCYFTLEGVHEVFQEEGLHTSIYSF-----DETKDL-DLEDIVRNIQASERVVIM---- 260

  Fly   249 IAMVDFVRGLQ---NRRLLESGDYIVVSVDDEIYDSNRRVNIMERNYLD-PYIRKEKSKSLDKIS 309
            .|..|.:|.:.   :|..:.||||...::  |:::|:        :|.| .:.|.:|.....|.:
Human   261 CASSDTIRSIMLVAHRHGMTSGDYAFFNI--ELFNSS--------SYGDGSWKRGDKHDFEAKQA 315

  Fly   310 FRSVIKISMTYPQNPHIRDICSKIKDYARKTPFLVPYHQRVFDNISVPIYGLHLYDSVMIYVRAI 374
            :.|:..:::.....|.......::|....|...      .:.|.:::.:.|.|  |::::||.|:
Human   316 YSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGL------NMEDYVNMFVEGFH--DAILLYVLAL 372

  Fly   375 TEVLRLGGDIYDGNLVMSHIFNRSYHSIQGFDVYIDSNGDAEGNYTVITLQNDVGSGAS------ 433
            .||||.|....||..::...:||::..|.| .|.||:|||..|:::||.: .||.:|..      
Human   373 HEVLRAGYSKKDGGKIIQQTWNRTFEGIAG-QVSIDANGDRYGDFSVIAM-TDVEAGTQEVIGDY 435

  Fly   434 IGSLAKMSMQPVGFFAYDKNSVIPEFRYIKNDRPIQWLNGRPPLAEPLCGFHGELCPRKKLDWRY 498
            .|...:..|:|...:.:.     |....|..:|.::..|..|      |...|.|   ::.....
Human   436 FGKEGRFEMRPNVKYPWG-----PLKLRIDENRIVEHTNSSP------CKSSGGL---EESAVTG 486

  Fly   499 LVSGPLCALVVVVAIALLIKHYR 521
            :|.|.|....:::|.....|.||
Human   487 IVVGALLGAGLLMAFYFFRKKYR 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365 94/403 (23%)
ANF_receptor 59..427 CDD:279440 88/376 (23%)
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003
CYCc 865..1057 CDD:214485
Guanylate_cyc 892..1076 CDD:278633
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 93/399 (23%)
ANF_receptor 71..422 CDD:279440 88/375 (23%)
TM_EphA1 476..507 CDD:214014 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.